Click image to see more details
Product Info Summary
| SKU: | PB9469 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-RAGE/AGER Antibody Picoband®
SKU/Catalog Number
PB9469
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-RAGE/AGER Antibody Picoband® catalog # PB9469. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-RAGE/AGER Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9469)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE, different from the related mouse and rat sequences by six amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9469 is reactive to AGER in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
45-58 kDa
Calculated molecular weight
42803 MW
Background of AGER
The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9469 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Rat
Positive Control
WB: Rat Lung Tissue, RH35 Whole Cell, HELA Whole Cell
IHC: mouse lung tissue, rat lung tissue, human intestinal cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of RAGE using anti-RAGE antibody (PB9469).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: Rat Lung Tissue Lysate at 50ug,
Lane 2: RH35 Whole Cell Lysate at 40ug,
Lane 3: HELA Whole Cell Lysate at 40ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-RAGE antigen affinity purified polyclonal antibody (Catalog # PB9469) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for RAGE at approximately 45-58 kDa. The expected band size for RAGE is at 43 kDa.
Click image to see more details
Figure 2. IHC analysis of RAGE using anti-RAGE antibody (PB9469).
RAGE was detected in a paraffin-embedded section of mouse lung tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-RAGE Antibody (PB9469) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of RAGE using anti-RAGE antibody (PB9469).
RAGE was detected in a paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-RAGE Antibody (PB9469) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of RAGE using anti-RAGE antibody (PB9469).
RAGE was detected in a paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-RAGE Antibody (PB9469) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For AGER (Source: Uniprot.org, NCBI)
Gene Name
AGER
Full Name
Advanced glycosylation end product-specific receptor
Weight
42803 MW
Alternative Names
Advanced glycosylation end product-specific receptor;Receptor for advanced glycosylation end products;AGER;RAGE; AGER RAGE, SCARJ1, sRAGE advanced glycosylation end-product specific receptor advanced glycosylation end product-specific receptor|receptor for advanced glycation end-products variant 20
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on AGER, check out the AGER Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for AGER: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-RAGE/AGER Antibody Picoband® (PB9469)
Hello CJ!
PB9469 has been cited in 7 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Ethyl pyruvate attenuated coxsackievirus B3-induced acute viral myocarditis by suppression of HMGB1/RAGE/NF-?B pathway
Li JY, Lu YH, Zhang LW, Zhou PM, Chen T. Ann Dermatol. 2017 Feb;29(1):121-123. doi: 10.5021/ad.2017.29.1.121. Epub 2017 Feb 3. Increased Serum High Mobility Group Box 1 (HMGB1) Concentration and the Altered Expression of HMGB1 and Its Receptor Adv...
Wang F, He Q, Wang J, Yuan Q, Guo H, Chai L, Wang S, Hu L, Zhang Y. BMC Complement Altern Med. 2017 May 10;17(1):258. doi: 10.1186/s12906-017-1738-8. Neuroprotective effect of salvianolate lyophilized injection against cerebral ischemia in type 1 ...
Qin Q, Niu J, Wang Z, Xu W, Qiao Z, Gu Y. Cardiovasc Diabetol. 2013 Feb 26;12:37. Doi: 10.1186/1475-2840-12-37. Heparanase Induced By Advanced Glycation End Products (Ages) Promotes Macrophage Migration Involving Rage And Pi3K/Akt Pathway.
Liu J, Wang S, Feng L, Ma D, Fu Q, Song Y, Jia X, Ma S. J Med Food. 2013 Jul;16(7):577-86. Doi: 10.1089/Jmf.2012.2654. Hypoglycemic And Antioxidant Activities Of Paeonol And Its Beneficial Effect On Diabetic Encephalopathy In Streptozotocin-Induce...
Wang L, Zhang X, Liu L, Yang R, Cui L, Li M. Neurosci Lett. 2010 Mar 8;471(3):152-6. Doi: 10.1016/J.Neulet.2010.01.030. Epub 2010 Jan 25. Atorvastatin Protects Rat Brains Against Permanent Focal Ischemia And Downregulates Hmgb1, Hmgb1 Receptors (R...
Wang L, Zhang X, Liu L, Cui L, Yang R, Li M, Du W. Brain Res. 2010 Mar 19;1321:143-51. Doi: 10.1016/J.Brainres.2009.12.046. Epub 2010 Jan 4. Tanshinone Ii A Down-Regulates Hmgb1, Rage, Tlr4, Nf-Kappab Expression, Ameliorates Bbb Permeability And E...
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-RAGE/AGER Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-RAGE/AGER Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-RAGE/AGER Antibody Picoband®
Question
I see that the anti-RAGE/AGER antibody PB9469 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2020-04-02
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-04-02
Question
I am interested in to test anti-RAGE/AGER antibody PB9469 on rat aortic smooth muscle lung for research purposes, then I may be interested in using anti-RAGE/AGER antibody PB9469 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-01-15
Answer
The products we sell, including anti-RAGE/AGER antibody PB9469, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-01-15
Question
Is this PB9469 anti-RAGE/AGER antibody reactive to the isotypes of AGER?
Verified Customer
Verified customer
Asked: 2019-11-08
Answer
The immunogen of PB9469 anti-RAGE/AGER antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI), different from the related mouse and rat sequences by six amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-11-08
Question
I was wanting to use your anti-RAGE/AGER antibody for IHC for rat aortic smooth muscle lung on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat aortic smooth muscle lung identification?
Verified Customer
Verified customer
Asked: 2019-08-29
Answer
You can see on the product datasheet, PB9469 anti-RAGE/AGER antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat aortic smooth muscle lung in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-08-29
Question
Would anti-RAGE/AGER antibody PB9469 work on pig IHC with aortic smooth muscle lung?
Verified Customer
Verified customer
Asked: 2018-01-19
Answer
Our lab technicians have not tested anti-RAGE/AGER antibody PB9469 on pig. You can run a BLAST between pig and the immunogen sequence of anti-RAGE/AGER antibody PB9469 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig aortic smooth muscle lung in IHC, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-01-19
Question
We are currently using anti-RAGE/AGER antibody PB9469 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on bovine tissues as well?
C. Miller
Verified customer
Asked: 2017-07-18
Answer
The anti-RAGE/AGER antibody (PB9469) has not been validated for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-07-18
Question
Is a blocking peptide available for product anti-RAGE/AGER antibody (PB9469)?
A. Bhatt
Verified customer
Asked: 2014-09-09
Answer
We do provide the blocking peptide for product anti-RAGE/AGER antibody (PB9469). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2014-09-09
