Product Info Summary
SKU: | PB9740 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-PTP4A2 Antibody Picoband®
View all PRL-2/PTP4A2 Antibodies
SKU/Catalog Number
PB9740
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-PTP4A2 Antibody Picoband® catalog # PB9740. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-PTP4A2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9740)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9740 is reactive to PTP4A2 in Human, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
19 kDa
Calculated molecular weight
19127 MW
Background of PRL-2/PTP4A2
Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9740 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot|0.1-0.5μg/ml, Human, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human
Positive Control
WB: human MOLT-4 whole cell, human T-47D whole cell, human Daudi whole cell, human RT4 whole cell, rat PC-12 whole cell
IHC: Human Prostatic Cancer tissue
FCM: U937 cell, MCF-7 cell, A431 cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of PTP4A2 using anti-PTP4A2 antibody (PB9740).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human MOLT-4 whole cell lysates,
Lane 2: human T-47D whole cell lysates,
Lane 3: human Daudi whole cell lysates,
Lane 4: human RT4 whole cell lysates,
Lane 5: rat PC-12 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PTP4A2 antigen affinity purified polyclonal antibody (Catalog # PB9740) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for PTP4A2 at approximately 19 kDa. The expected band size for PTP4A2 is at 19 kDa.
Click image to see more details
Figure 2. IHC analysis of PTP4A2 using anti-PTP4A2 antibody (PB9740).
PTP4A2 was detected in paraffin-embedded section of Human Prostatic Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-PTP4A2 Antibody (PB9740) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. Flow Cytometry analysis of MCF-7 cells using anti-PTP4A2 antibody (PB9740).
Overlay histogram showing MCF-7 cells stained with PB9740 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (PB9740, 1 μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10 μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1 μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Click image to see more details
Figure 4. Flow Cytometry analysis of PC-3 cells using anti-PTP4A2 antibody (PB9740).
Overlay histogram showing PC-3 cells stained with PB9740 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (PB9740,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Click image to see more details
Figure 5. Flow Cytometry analysis of A431 cells using anti-PTP4A2 antibody (PB9740).
Overlay histogram showing A431 cells stained with PB9740 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (PB9740,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For PTP4A2 (Source: Uniprot.org, NCBI)
Gene Name
PTP4A2
Full Name
Protein tyrosine phosphatase type IVA 2
Weight
19127 MW
Superfamily
protein-tyrosine phosphatase family
Alternative Names
Protein tyrosine phosphatase type IVA 2;3.1.3.48;HU-PP-1;OV-1;PTP (CAAXII);Protein-tyrosine phosphatase 4a2;Protein-tyrosine phosphatase of regenerating liver 2;PRL-2;PTP4A2;PRL2, PTPCAAX2;BM-008; PTP4A2 HH13, HH7-2, HU-PP-1, OV-1, PRL-2, PRL2, PTP4A, PTPCAAX2, ptp-IV1a, ptp-IV1b protein tyrosine phosphatase 4A2 protein tyrosine phosphatase type IVA 2|PTP(CAAXII)|phosphatase of regenerating liver 2|protein tyrosine phosphatase IVA|protein tyrosine phosphatase IVA2|protein tyrosine phosphatase type IVA, member 2|protein-tyrosine phosphatase of regenerating liver 2
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on PTP4A2, check out the PTP4A2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PTP4A2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-PTP4A2 Antibody Picoband® (PB9740)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-PTP4A2 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-PTP4A2 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-PTP4A2 Antibody Picoband®
Question
Is this PB9740 anti-PTP4A2 antibody reactive to the isotypes of PTP4A2?
Verified Customer
Verified customer
Asked: 2019-11-18
Answer
The immunogen of PB9740 anti-PTP4A2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40-69aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-11-18
Question
Does PB9740 anti-PTP4A2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-10-02
Answer
It shows on the product datasheet, PB9740 anti-PTP4A2 antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-10-02
Question
Is a blocking peptide available for product anti-PTP4A2 antibody (PB9740)?
S. Anderson
Verified customer
Asked: 2019-01-02
Answer
We do provide the blocking peptide for product anti-PTP4A2 antibody (PB9740). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-01-02
Question
We are currently using anti-PTP4A2 antibody PB9740 for rat tissue, and we are happy with the Flow Cytometry results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on pig tissues as well?
A. Wu
Verified customer
Asked: 2017-08-01
Answer
The anti-PTP4A2 antibody (PB9740) has not been tested for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-08-01
Question
Do you have a BSA free version of anti-PTP4A2 antibody PB9740 available?
K. Miller
Verified customer
Asked: 2015-02-03
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-PTP4A2 antibody PB9740 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2015-02-03
Question
I see that the anti-PTP4A2 antibody PB9740 works with IHC, what is the protocol used to produce the result images on the product page?
J. Li
Verified customer
Asked: 2014-09-09
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2014-09-09