Anti-PTP4A2 Antibody Picoband®

PRL-2/PTP4A2 antibody

Boster Bio Anti-PTP4A2 Antibody Picoband® catalog # PB9740. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB9740
Size: 100 μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Product Name

Anti-PTP4A2 Antibody Picoband®

View all PRL-2/PTP4A2 Antibodies

SKU/Catalog Number

PB9740

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-PTP4A2 Antibody Picoband® catalog # PB9740. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PTP4A2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9740)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9740 is reactive to PTP4A2 in Human, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

19 kDa

Calculated molecular weight

19127 MW

Background of PRL-2/PTP4A2

Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9740 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot|0.1-0.5μg/ml, Human, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: human MOLT-4 whole cell, human T-47D whole cell, human Daudi whole cell, human RT4 whole cell, rat PC-12 whole cell
IHC: Human Prostatic Cancer tissue
FCM: U937 cell, MCF-7 cell, A431 cell

Validation Images & Assay Conditions

Gene/Protein Information For PTP4A2 (Source: Uniprot.org, NCBI)

Gene Name

PTP4A2

Full Name

Protein tyrosine phosphatase type IVA 2

Weight

19127 MW

Superfamily

protein-tyrosine phosphatase family

Alternative Names

Protein tyrosine phosphatase type IVA 2;3.1.3.48;HU-PP-1;OV-1;PTP (CAAXII);Protein-tyrosine phosphatase 4a2;Protein-tyrosine phosphatase of regenerating liver 2;PRL-2;PTP4A2;PRL2, PTPCAAX2;BM-008; PTP4A2 HH13, HH7-2, HU-PP-1, OV-1, PRL-2, PRL2, PTP4A, PTPCAAX2, ptp-IV1a, ptp-IV1b protein tyrosine phosphatase 4A2 protein tyrosine phosphatase type IVA 2|PTP(CAAXII)|phosphatase of regenerating liver 2|protein tyrosine phosphatase IVA|protein tyrosine phosphatase IVA2|protein tyrosine phosphatase type IVA, member 2|protein-tyrosine phosphatase of regenerating liver 2

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on PTP4A2, check out the PTP4A2 Infographic

PTP4A2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PTP4A2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used Anti-PTP4A2 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-PTP4A2 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-PTP4A2 Antibody Picoband®

Question

Is this PB9740 anti-PTP4A2 antibody reactive to the isotypes of PTP4A2?

Verified Customer

Verified customer

Asked: 2019-11-18

Answer

The immunogen of PB9740 anti-PTP4A2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40-69aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-11-18

Question

Does PB9740 anti-PTP4A2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-10-02

Answer

It shows on the product datasheet, PB9740 anti-PTP4A2 antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-10-02

Question

Is a blocking peptide available for product anti-PTP4A2 antibody (PB9740)?

S. Anderson

Verified customer

Asked: 2019-01-02

Answer

We do provide the blocking peptide for product anti-PTP4A2 antibody (PB9740). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-01-02

Question

We are currently using anti-PTP4A2 antibody PB9740 for rat tissue, and we are happy with the Flow Cytometry results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on pig tissues as well?

A. Wu

Verified customer

Asked: 2017-08-01

Answer

The anti-PTP4A2 antibody (PB9740) has not been tested for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-08-01

Question

Do you have a BSA free version of anti-PTP4A2 antibody PB9740 available?

K. Miller

Verified customer

Asked: 2015-02-03

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-PTP4A2 antibody PB9740 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2015-02-03

Question

I see that the anti-PTP4A2 antibody PB9740 works with IHC, what is the protocol used to produce the result images on the product page?

J. Li

Verified customer

Asked: 2014-09-09

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2014-09-09

Order DetailsPrice
PB9740

100μg

$370
PB9740-10ug

10μg sample (liquid)

$99
PB9740-Biotin

100 μg Biotin conjugated

$570
PB9740-Cy3

100 μg Cy3 conjugated

$570
PB9740-Dylight488

100 μg Dylight488 conjugated

$570
PB9740-Dylight550

100 μg Dylight550 conjugated

$570
PB9740-Dylight594

100 μg Dylight594 conjugated

$570
PB9740-FITC

100 μg FITC conjugated

$570
PB9740-HRP

100 μg HRP conjugated

$570
PB9740-APC

100 μg APC conjugated

$670
PB9740-PE

100 μg PE conjugated

$670
PB9740-iFluor647

100 μg iFluor647 conjugated

$670
PB9740-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9740
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.