Anti-PKC gamma/PRKCG Antibody Picoband®

PKC gamma antibody

Boster Bio Anti-PKC gamma/PRKCG Antibody Picoband® catalog # A01890. Tested in ICC/IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 3 publication(s).

Product Info Summary

SKU: A01890
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC, ICC, WB

Product Name

Anti-PKC gamma/PRKCG Antibody Picoband®

View all PKC gamma Antibodies

SKU/Catalog Number

A01890

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-PKC gamma/PRKCG Antibody Picoband® catalog # A01890. Tested in ICC/IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PKC gamma/PRKCG Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01890)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human PKC gamma/PRKCG, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A01890 is reactive to PRKCG in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

78 kDa

Calculated molecular weight

146424 MW

Background of PKC gamma

The gamma isotype of protein kinase C (PKC gamma) is a member of the classical PKC (cPKC) subfamily which is activated by Ca (2+) and diacylglycerol in the presence of phosphatidylserine. Physiologically, PKC gamma is activated by a mechanism coupled with receptor-mediated breakdown of inositol phospholipid as other cPKC isotypes such as PKC alpha and PKC beta. PKC gamma is expressed solely in the brain and spinal cord and its localization is restricted to neurons, while PKC alpha and PKC beta are expressed in many tissues in addition to the brain. Within the brain, PKC gamma is the most abundant in the cerebellum, hippocampus and cerebral cortex, where the existence of neuronal plasticity has been demonstrated. PKC gamma gene is mutated in spinocerebellar ataxia type 14 (SCA14). Verbeek et al. (2005) point out the specific alterations in mutant PKC gamma function that could lead to the selective neuronal degeneration of SCA14.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A01890 is guaranteed for IF, IHC, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 5μg/ml

Positive Control

WB: human U87 whole cell, rat brain tissue, mouse brain tissue, rat kidney tissue, mouse kidney tissue
IHC: human glioma tissue, mouse brain tissue, mouse brain tissue, rat brain tissue, mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat celebellum tissue
ICC/IF: SH-SY5Y cell
IF: rat celebellum tissue

Validation Images & Assay Conditions

Gene/Protein Information For PRKCG (Source: Uniprot.org, NCBI)

Gene Name

PRKCG

Full Name

Protein kinase C gamma type

Weight

146424 MW

Superfamily

protein kinase superfamily

Alternative Names

Protein kinase C gamma type; PKC-gamma; PRKCG; PKCG PRKCG PKC-gamma, PKCC, PKCG, PKCI(3), PKCgamma, SCA14 protein kinase C gamma protein kinase C gamma type

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on PRKCG, check out the PRKCG Infographic

PRKCG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRKCG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A01890 has been cited in 3 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

5-(Bis(3-(2-hydroxyethyl)-1H-indol-2-yl)methyl)-2-hydroxybenzoic acid (BHIMHA): showing a strategy of designing drug to block lung metastasis of tumors

5-(Bis(3-(2-hydroxyethyl)-1H-indol-2-yl)methyl)-2-hydroxybenzoic acid (BHIMHA): showing a strategy of designing drug to block lung metastasis of tumors

Extracts from Salvia-Nelumbinis naturalis alleviate hepatosteatosis via improving hepatic insulin sensitivity

Have you used Anti-PKC gamma/PRKCG Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-PKC gamma/PRKCG Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-PKC gamma/PRKCG Antibody Picoband®

Question

Will A01890 anti-PKC gamma/PRKCG antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-04-29

Answer

You can see on the product datasheet, A01890 anti-PKC gamma/PRKCG antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-04-29

Question

Is this A01890 anti-PKC gamma/PRKCG antibody reactive to the isotypes of PRKCG?

S. Huang

Verified customer

Asked: 2019-12-25

Answer

The immunogen of A01890 anti-PKC gamma/PRKCG antibody is A synthetic peptide corresponding to a sequence of human PKC gamma/PRKCG (DRLVLASIDQADFQGFTYVNPDFVHPDARS). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-12-25

Question

My question regards to test anti-PKC gamma/PRKCG antibody A01890 on rat brain for research purposes, then I may be interested in using anti-PKC gamma/PRKCG antibody A01890 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-05-13

Answer

The products we sell, including anti-PKC gamma/PRKCG antibody A01890, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-05-13

Question

We are currently using anti-PKC gamma/PRKCG antibody A01890 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2018-02-09

Answer

The anti-PKC gamma/PRKCG antibody (A01890) has not been tested for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-02-09

Question

I see that the anti-PKC gamma/PRKCG antibody A01890 works with WB, what is the protocol used to produce the result images on the product page?

R. Brown

Verified customer

Asked: 2014-04-03

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2014-04-03

Question

My question regarding product A01890, anti-PKC gamma/PRKCG antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

E. Rodriguez

Verified customer

Asked: 2013-12-11

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01890 anti-PKC gamma/PRKCG antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2013-12-11

Order DetailsPrice
A01890

100μg

$370
A01890-10ug

10μg sample (liquid)

$99
A01890-Biotin

100 μg Biotin conjugated

$570
A01890-Cy3

100 μg Cy3 conjugated

$570
A01890-Dylight488

100 μg Dylight488 conjugated

$570
A01890-Dylight550

100 μg Dylight550 conjugated

$570
A01890-Dylight594

100 μg Dylight594 conjugated

$570
A01890-FITC

100 μg FITC conjugated

$570
A01890-HRP

100 μg HRP conjugated

$570
A01890-APC

100 μg APC conjugated

$670
A01890-PE

100 μg PE conjugated

$670
A01890-iFluor647

100 μg iFluor647 conjugated

$670
A01890-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01890
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.