Click image to see more details
Product Info Summary
| SKU: | PB9771 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-PDGF Receptor alpha/PDGFRA Antibody Picoband®
View all PDGFR alpha Antibodies
SKU/Catalog Number
PB9771
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-PDGF Receptor alpha/PDGFRA Antibody Picoband® catalog # PB9771. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-PDGF Receptor alpha/PDGFRA Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9771)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PDGFRA, identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9771 is reactive to PDGFRA in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
123 kDa
Calculated molecular weight
122670 MW
Background of PDGFR alpha
PDGFRA (Platelet-derived growth factor receptor, alpha), also called PDGFR2, encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. The PDGFA gene is mapped on 4q12. The PDGFRA-FIP1L1 gene is a constitutively activated tyrosine kinase that transforms hematopoietic cells and is a therapeutic target of imatinib. And the PDGFRA gene contains 23 exons spanning about 65 kb. Using the human PDGFRA promoter linked to a luciferase reporter, Joosten et al. showed that PAX1 acts as a transcriptional activator of the PDGFRA gene in differentiated human embryonal carcinoma cells. PDGFRA is responsible for mediating cellular contraction of multiple growth factors: TGFB1 and members of the PDGF family. Lei et al. noted that in the rabbit model of the disease, PDGFRA is dramatically more capable of promoting PVR than is the closely related PDGFRB. PDGFRA is a critical receptor required for human CMV infection, and thus a target for novel antiviral therapies.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9771 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Positive Control
WB: human HT1080 whole cell, human Caco-2 whole cell, human U20S whole cell, human PC-3 whole cell, human 293T whole cell
IHC: Human Intestinal Cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of PDGFRA using anti-PDGFRA antibody (PB9771).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human HT1080 whole cell lysates,
Lane 2: human Caco-2 whole cell lysates,
Lane 3: human U20S whole cell lysates,
Lane 4: human PC-3 whole cell lysates,
Lane 5: human 293T whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PDGFRA antigen affinity purified polyclonal antibody (Catalog # PB9771) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for PDGFRA at approximately 123KD. The expected band size for PDGFRA is at 180KD.
Click image to see more details
Figure 2. IHC analysis of PDGFRA using anti-PDGFRA antibody (PB9771).
PDGFRA was detected in paraffin-embedded section of Human Intestinal Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-PDGFRA Antibody (PB9771) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For PDGFRA (Source: Uniprot.org, NCBI)
Gene Name
PDGFRA
Full Name
Platelet-derived growth factor receptor alpha
Weight
122670 MW
Superfamily
protein kinase superfamily
Alternative Names
Platelet-derived growth factor receptor alpha;PDGF-R-alpha;PDGFR-alpha;2.7.10.1;Alpha platelet-derived growth factor receptor;Alpha-type platelet-derived growth factor receptor;CD140 antigen-like family member A;CD140a antigen;Platelet-derived growth factor alpha receptor;Platelet-derived growth factor receptor 2;PDGFR-2;CD140a;PDGFRA;PDGFR2, RHEPDGFRA; PDGFRA CD140A, PDGFR-2, PDGFR2 platelet derived growth factor receptor alpha platelet-derived growth factor receptor alpha|CD140 -like family member A|CD140a |PDGF-R-alpha|alpha-type platelet-derived growth factor receptor|platelet-derived growth factor receptor 2|platelet-derived growth factor receptor, alpha polypeptide
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on PDGFRA, check out the PDGFRA Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PDGFRA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-PDGF Receptor alpha/PDGFRA Antibody Picoband® (PB9771)
Hello CJ!
PB9771 has been cited in 3 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Janus Kinase 1 Plays a Critical Role in Mammary Cancer Progression
PDGFR%u03B1 regulated by miR-34a and FoxO1 promotes adipogenesis in porcine intramuscular preadipocytes through Erk signaling pathway
Label-retaining assay enriches tumor-initiating cells in glioblastoma spheres cultivated in serum-free medium
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-PDGF Receptor alpha/PDGFRA Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-PDGF Receptor alpha/PDGFRA Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-PDGF Receptor alpha/PDGFRA Antibody Picoband®
Question
Here are the WB image, lot number and protocol we used for foreskin using anti-PDGF Receptor alpha/PDGFRA antibody PB9771. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-05-08
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-05-08
Question
I am looking for using your anti-PDGF Receptor alpha/PDGFRA antibody for positive regulation of phosphatidylinositol 3-kinase activity studies. Has this antibody been tested with western blotting on human u20s? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2020-03-17
Answer
We appreciate your inquiry. This PB9771 anti-PDGF Receptor alpha/PDGFRA antibody is validated on human u20s, u20s whole cell lysates, 293t whole cell lysates, intestinal cancer tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2020-03-17
Question
My team were well pleased with the WB result of your anti-PDGF Receptor alpha/PDGFRA antibody. However we have seen positive staining in foreskin cell membrane using this antibody. Is that expected? Could you tell me where is PDGFRA supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-02-24
Answer
According to literature, foreskin does express PDGFRA. Generally PDGFRA expresses in cell membrane. Regarding which tissues have PDGFRA expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 8586421
Brain, Pubmed ID: 2536956
Colon tumor, Pubmed ID: 7896447
Eosinophil, Pubmed ID: 12808148
Foreskin, Pubmed ID: 2544881
Lung, and Trachea, Pubmed ID: 14702039
Placenta, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2020-02-24
Question
Would PB9771 anti-PDGF Receptor alpha/PDGFRA antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
J. Lewis
Verified customer
Asked: 2019-12-24
Answer
It shows on the product datasheet, PB9771 anti-PDGF Receptor alpha/PDGFRA antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-12-24
Question
Will anti-PDGF Receptor alpha/PDGFRA antibody PB9771 work for IHC with foreskin?
Verified Customer
Verified customer
Asked: 2019-11-05
Answer
According to the expression profile of foreskin, PDGFRA is highly expressed in foreskin. So, it is likely that anti-PDGF Receptor alpha/PDGFRA antibody PB9771 will work for IHC with foreskin.
Boster Scientific Support
Answered: 2019-11-05
Question
I see that the anti-PDGF Receptor alpha/PDGFRA antibody PB9771 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-09-26
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-09-26
Question
I was wanting to use your anti-PDGF Receptor alpha/PDGFRA antibody for IHC for human foreskin on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human foreskin identification?
Verified Customer
Verified customer
Asked: 2019-09-25
Answer
You can see on the product datasheet, PB9771 anti-PDGF Receptor alpha/PDGFRA antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human foreskin in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-09-25
Question
Is this PB9771 anti-PDGF Receptor alpha/PDGFRA antibody reactive to the isotypes of PDGFRA?
Verified Customer
Verified customer
Asked: 2019-07-02
Answer
The immunogen of PB9771 anti-PDGF Receptor alpha/PDGFRA antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human PDGFRA (968-1002aa DFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-07-02
Question
We are currently using anti-PDGF Receptor alpha/PDGFRA antibody PB9771 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on canine tissues as well?
Verified Customer
Verified customer
Asked: 2018-12-26
Answer
The anti-PDGF Receptor alpha/PDGFRA antibody (PB9771) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-12-26
Question
Is a blocking peptide available for product anti-PDGF Receptor alpha/PDGFRA antibody (PB9771)?
Verified Customer
Verified customer
Asked: 2018-08-03
Answer
We do provide the blocking peptide for product anti-PDGF Receptor alpha/PDGFRA antibody (PB9771). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-08-03
Question
Our lab used your anti-PDGF Receptor alpha/PDGFRA antibody for WB on blood in a previous project. I am using rat, and I plan to use the antibody for IHC next. I am interested in examining blood as well as endometrium in our next experiment. Could you please give me some suggestion on which antibody would work the best for IHC?
Verified Customer
Verified customer
Asked: 2018-03-23
Answer
I have checked the website and datasheets of our anti-PDGF Receptor alpha/PDGFRA antibody and it seems that PB9771 has been validated on rat in both WB and IHC. Thus PB9771 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2018-03-23
Question
We want to test anti-PDGF Receptor alpha/PDGFRA antibody PB9771 on human foreskin for research purposes, then I may be interested in using anti-PDGF Receptor alpha/PDGFRA antibody PB9771 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
P. Li
Verified customer
Asked: 2018-01-31
Answer
The products we sell, including anti-PDGF Receptor alpha/PDGFRA antibody PB9771, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-01-31
Question
I have a question about product PB9771, anti-PDGF Receptor alpha/PDGFRA antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2017-08-25
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9771 anti-PDGF Receptor alpha/PDGFRA antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2017-08-25
Question
I have attached the WB image, lot number and protocol we used for foreskin using anti-PDGF Receptor alpha/PDGFRA antibody PB9771. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2017-05-18
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-05-18
Question
We have seen staining in mouse eosinophil. Are there any suggestions? Is anti-PDGF Receptor alpha/PDGFRA antibody supposed to stain eosinophil positively?
A. Parker
Verified customer
Asked: 2015-12-30
Answer
Based on literature eosinophil does express PDGFRA. Based on Uniprot.org, PDGFRA is expressed in endometrium, foreskin, brain, blood, lung trachea, placenta, eosinophil, colon tumor, among other tissues. Regarding which tissues have PDGFRA expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 8586421
Brain, Pubmed ID: 2536956
Colon tumor, Pubmed ID: 7896447
Eosinophil, Pubmed ID: 12808148
Foreskin, Pubmed ID: 2544881
Lung, and Trachea, Pubmed ID: 14702039
Placenta, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2015-12-30
Question
Do you have a BSA free version of anti-PDGF Receptor alpha/PDGFRA antibody PB9771 available?
M. Anderson
Verified customer
Asked: 2014-02-20
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-PDGF Receptor alpha/PDGFRA antibody PB9771 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2014-02-20
