Click image to see more details
Product Info Summary
| SKU: | A00661-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-NKG2D/KLRK1 Antibody Picoband®
View all NKG2D/CD314 Antibodies
SKU/Catalog Number
A00661-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-NKG2D/KLRK1 Antibody Picoband® catalog # A00661-1. Tested in WB applications. This antibody reacts with Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-NKG2D/KLRK1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00661-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human NKG2D, which shares 76.7% amino acid (aa) sequence identity with both mouse and rat NKG2D.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00661-1 is reactive to KLRK1 in Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
35 kDa
Calculated molecular weight
25.274kDa
Background of NKG2D/CD314
NKG2D is encoded by KLRK1 gene which is located in the NK-gene complex (NKC) situated on and chromosome 12 in humans. Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. This gene encodes a member of the NKG2 family. The encoded transmembrane protein is characterized by a type II membrane orientation (has an extracellular C terminus) and the presence of a C-type lectin domain. It binds to a diverse family of ligands that include MHC class I chain-related A and B proteins and UL-16 binding proteins, where ligand-receptor interactions can result in the activation of NK and T cells. The surface expression of these ligands is important for the recognition of stressed cells by the immune system, and thus this protein and its ligands are therapeutic targets for the treatment of immune diseases and cancers. Read-through transcription exists between this gene and the upstream KLRC4 (killer cell lectin-like receptor subfamily C, member 4) family member in the same cluster.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00661-1 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Positive Control
WB: rat lymph tissue, rat spleen tissue, mouse thymus tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of NKG2D using anti-NKG2D antibody (A00661-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat lymph tissue lysates,
Lane 2: rat spleen tissue lysates,
Lane 3: mouse thymus tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-NKG2D antigen affinity purified polyclonal antibody (Catalog # A00661-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for NKG2D at approximately 35KD. The expected band size for NKG2D is at 25KD.
Protein Target Info & Infographic
Gene/Protein Information For KLRK1 (Source: Uniprot.org, NCBI)
Gene Name
KLRK1
Full Name
NKG2-D type II integral membrane protein
Weight
25.274kDa
Alternative Names
NKG2-D type II integral membrane protein; Killer cell lectin-like receptor subfamily K member 1; NK cell receptor D; NKG2-D-activating NK receptor; CD314; KLRK1; D12S2489E; NKG2D KLRK1 CD314, D12S2489E, KLR, NKG2-D, NKG2D killer cell lectin like receptor K1 NKG2-D type II integral membrane protein|NK cell receptor D|NKG2-D-activating NK receptor|killer cell lectin-like receptor subfamily K, member 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on KLRK1, check out the KLRK1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for KLRK1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-NKG2D/KLRK1 Antibody Picoband® (A00661-1)
Hello CJ!
No publications found for A00661-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-NKG2D/KLRK1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-NKG2D/KLRK1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-NKG2D/KLRK1 Antibody Picoband®
Question
Is a blocking peptide available for product anti-NKG2D/KLRK1 antibody (A00661-1)?
Verified Customer
Verified customer
Asked: 2019-11-29
Answer
We do provide the blocking peptide for product anti-NKG2D/KLRK1 antibody (A00661-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-11-29
Question
Is this A00661-1 anti-NKG2D/KLRK1 antibody reactive to the isotypes of KLRK1?
Verified Customer
Verified customer
Asked: 2019-05-31
Answer
The immunogen of A00661-1 anti-NKG2D/KLRK1 antibody is A synthetic peptide corresponding to a sequence of human NKG2D (YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-05-31
Question
We are currently using anti-NKG2D/KLRK1 antibody A00661-1 for mouse tissue, and we are content with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it true that the antibody can work on monkey tissues as well?
Verified Customer
Verified customer
Asked: 2018-11-23
Answer
The anti-NKG2D/KLRK1 antibody (A00661-1) has not been validated for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-11-23
Question
Would A00661-1 anti-NKG2D/KLRK1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2018-03-19
Answer
You can see on the product datasheet, A00661-1 anti-NKG2D/KLRK1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-03-19
Question
I see that the anti-NKG2D/KLRK1 antibody A00661-1 works with WB, what is the protocol used to produce the result images on the product page?
J. Lewis
Verified customer
Asked: 2017-01-12
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2017-01-12
