Click image to see more details
Product Info Summary
| SKU: | PB9906 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-NIRF/UHRF2 Antibody Picoband®
SKU/Catalog Number
PB9906
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-NIRF/UHRF2 Antibody Picoband® catalog # PB9906. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-NIRF/UHRF2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9906)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9906 is reactive to UHRF2 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
90 kDa
Calculated molecular weight
89985 MW
Background of NIRF
E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9906 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Rat
Positive Control
WB: rat testis tissue, K562 whole cell
IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of NIRF using anti-NIRF antibody (PB9906).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat testis tissue lysates,
Lane 2: K562 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-NIRF antigen affinity purified polyclonal antibody (Catalog # PB9906) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for NIRF at approximately 90 kDa. The expected band size for NIRF is at 90 kDa.
Click image to see more details
Figure 2. IHC analysis of NIRF using anti-NIRF antibody (PB9906).
NIRF was detected in a paraffin-embedded section of mouse intestine tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-NIRF Antibody (PB9906) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of NIRF using anti-NIRF antibody (PB9906).
NIRF was detected in a paraffin-embedded section of rat intestine tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-NIRF Antibody (PB9906) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of NIRF using anti-NIRF antibody (PB9906).
NIRF was detected in a paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-NIRF Antibody (PB9906) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For UHRF2 (Source: Uniprot.org, NCBI)
Gene Name
UHRF2
Full Name
E3 ubiquitin-protein ligase UHRF2
Weight
89985 MW
Alternative Names
E3 ubiquitin-protein ligase UHRF2;6.3.2.-;Np95/ICBP90-like RING finger protein;Np95-like RING finger protein;Nuclear protein 97;Nuclear zinc finger protein Np97;RING finger protein 107;Ubiquitin-like PHD and RING finger domain-containing protein 2;Ubiquitin-like-containing PHD and RING finger domains protein 2;UHRF2;NIRF, RNF107; Uhrf2|2310065A22Rik, AI426270, AW214556, D130071B19Rik, N, Nirf|ubiquitin-like, containing PHD and RING finger domains 2|E3 ubiquitin-protein ligase UHRF2|Np95-like ring finger protein|RING-type E3 ubiquitin transferase UHRF2|nuclear protein 97|nuclear zinc finger protein Np97|ubiquitin-like PHD and RING finger domain-containing protein 2|ubiquitin-like-containing PHD and RING finger domains protein 2
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on UHRF2, check out the UHRF2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for UHRF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-NIRF/UHRF2 Antibody Picoband® (PB9906)
Hello CJ!
PB9906 has been cited in 2 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Overexpression of UHRF2 in intrahepatic cholangiocarcinoma and its clinical significance
Overexpression of UHRF2 in intrahepatic cholangiocarcinoma and its clinical significance
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-NIRF/UHRF2 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-NIRF/UHRF2 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-NIRF/UHRF2 Antibody Picoband®
Question
Is this PB9906 anti-NIRF/UHRF2 antibody reactive to the isotypes of UHRF2?
Verified Customer
Verified customer
Asked: 2019-09-18
Answer
The immunogen of PB9906 anti-NIRF/UHRF2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-09-18
Question
We are currently using anti-NIRF/UHRF2 antibody PB9906 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on horse tissues as well?
J. Evans
Verified customer
Asked: 2019-04-26
Answer
The anti-NIRF/UHRF2 antibody (PB9906) has not been tested for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-04-26
Question
Is there a BSA free version of anti-NIRF/UHRF2 antibody PB9906 available?
Verified Customer
Verified customer
Asked: 2019-04-02
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-NIRF/UHRF2 antibody PB9906 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-04-02
Question
Is a blocking peptide available for product anti-NIRF/UHRF2 antibody (PB9906)?
A. Li
Verified customer
Asked: 2017-08-14
Answer
We do provide the blocking peptide for product anti-NIRF/UHRF2 antibody (PB9906). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2017-08-14
Question
Can you help my question with product PB9906, anti-NIRF/UHRF2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
N. Bhatt
Verified customer
Asked: 2017-04-26
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9906 anti-NIRF/UHRF2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2017-04-26
Question
Does PB9906 anti-NIRF/UHRF2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
K. Lewis
Verified customer
Asked: 2016-01-19
Answer
As indicated on the product datasheet, PB9906 anti-NIRF/UHRF2 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2016-01-19
Question
I was wanting to use your anti-NIRF/UHRF2 antibody for WB for human cervix carcinoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human cervix carcinoma identification?
A. Edwards
Verified customer
Asked: 2015-02-19
Answer
You can see on the product datasheet, PB9906 anti-NIRF/UHRF2 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human cervix carcinoma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2015-02-19
