Anti-Neuropeptide Y/NPY Picoband™ Antibody

SKU PB9296
Size 100μg/vial
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Ig Isotype N/A
Applications IHC, WB


Product Name Anti-Neuropeptide Y/NPY Picoband™ Antibody
SKU/Catalog Number PB9296
Storage & Handling At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Size 100μg/vial
Description Rabbit IgG polyclonal antibody for Pro-neuropeptide Y(NPY) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Cite This Product Anti-Neuropeptide Y/NPY Picoband™ Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9296)
Host Rabbit
Contents/Buffer Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Form Lyophilized
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences.
Reactivity Human, Mouse, Rat

Assay Details

Assay Dilutions Overview

Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunohistochemistry(Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human

Boster's Secondary Antibodies And IHC, WB Kits

The following reagents are used to generate the images below.

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Images And Assay Conditions

All lanes: Anti Neuropeptide Y (PB9296) at 0.5ug/ml
WB: Recombinant Human Neuropeptide Y Protein 0.5ng
Predicted bind size: 11KD
Observed bind size: 11KD

Anti- Neuropeptide Y Picoband antibody, PB9296,IHC(P)
IHC(P): Mouse Brain Tissue

Anti- Neuropeptide Y Picoband antibody, PB9296,IHC(P)
IHC(P): Rat Brain Tissue

Target Info

Protein Target Info (Source:

Uniprot Id P01303
Gene Name NPY
Protein Name Pro-neuropeptide Y
Tissue Specificity One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
Alternative Names Pro-neuropeptide Y;Neuropeptide Y;Neuropeptide tyrosine;NPY;C-flanking peptide of NPY;CPON;NPY;
Subcellular Localization Secreted.
Molecular Weight 10851 MW

*if product is indicated to react with multiple species, protein info is based on the human gene.


Protein Function NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Research Areas Human, Mouse, Rat

*You can search these to find other products in these research areas.
Background This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi.

Other Recommended Resources

Here are featured tools and databases that you might find useful.

Write Your Own Review
Only registered users can write reviews. Please Sign in or create an account
In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

We promise all of our products perform as described in datasheets.

Write a review for PB9296


Long-Term l-Serine Administration Reduces Food Intake and Improves Oxidative Stress and Sirt1/NF%u03BAB Signaling in the Hypothalamus of Aging Mice
Different Effects of Implanting Sensory Nerve or Blood Vessel on the Vascularization, Neurotization, and Osteogenesis of Tissue-Engineered Bone In Vivo
Wang Sx, Chen Jx, Yue Gx, Bai Mh, Kou Mj, Jin Zy. Evid Based Complement Alternat Med. 2012;2012:381278. Doi: 10.1155/2012/381278. Epub 2012 Nov 13. Xiaoyaosan Decoction Regulates Changes In Neuropeptide Y And Leptin Receptor In The Rat Arcuate Nuc...
Song C, Yang Z, Zhong M, Chen Z. Neural Regen Res. 2013 Feb 25;8(6):506-13. Doi: 10.3969/J.Issn.1673-5374.2013.06.003. Sericin Protects Against Diabetes-Induced Injuries In Sciatic Nerve And Related Nerve Cells.
Wang H, Zhou N, Zhang R, Wu Y, Zhang R, Zhang S. Acta Histochem. 2014 Oct;116(8):1418-26. Doi: 10.1016/J.Acthis.2014.09.005. Epub 2014 Oct 23. Identification And Localization Of Gastrointestinal Hormones In The Skin Of The Bullfrog Rana Catesbeian...
Huang J, Zhu C, Zhang P, Zhu Q, Liu Y, Zhu Z, Wang M, Li W, Yang G, Dong N, Liu J, Chen L, Zhang Y, Yang R, Deng L, Fan J, Wang X, Liu J, Ma B, Fu Q, Wu K. Sci Rep. 2013;3:1114. Doi: 10.1038/Srep01114. Epub 2013 Jan 23. S100+ Cells: A New Neuro-Im...

Customer Q&As

  • Q: Do you offer BSA-free antibodies? Keyword: Bovine serum albumin, carrier protein, conjugation
    A: Yes, please contact us at [email protected] for more information about BSA-free antibodies and availability. The new BSA-free formula uses trehalose as a replacement to BSA. We have tested many alternative chemicals and found that trehalose protects the antibodies the best.
  • Q: Can I conjugate markers to this antibody? Can I link custom conjugates to this antibody? Keyword: conjugation
    A: The antibody is stored with BSA and cannot be conjugated with markers. Carrier free antibodies are available upon request. Please contact [email protected]
  • Q: What should I use for negative control?
    A: Please contact us for negative control suggestions. You can also check expression databases such as genecards, uniprot etc. Due to logistic reasons, we do not sell serum or lysates that we use internally for positive or negative control.
  • Q: Where can I find troubleshooting information? What should I do if I have unexpected bands, high background, no signal, weak signal
    A: You can find Boster's troubleshoot guides under tech support tab. Please contact us for further assistance on troubleshooting your experiment.
  • Q: What is the immunogen sequence of this antibody? Is this antibody polyclonal or monoclonal?
    A: You can find the immunogen sequence under "
  • Q: What is the expected band size? Why is it different than the observed band size?
    A: The expected band size is predicted on the size of the protein. The actual band size may be affected by a few other factors including but not limited to:<br>1. Post-translational modification:phosphorylation, methylation, glycosylation etc. These modifications prevent SDS molecules from binding to the target protein and thus make the band size appear larger than expected<br>2. Post-translational cleavage: this can cause smaller bands and or multiple bands <br><br>3. Alternative splicing: the same gene can have alternative splicing patterns generating different size proteins, all with reactivities to the antibody. <br><br>4. Amino Acid R chain charge: SDS binds to positive charges. The different size and charge of the Amino Acid side chains can affect the amount of SDS binding and thus affect the observed band size.<br>5. Multimers: Multimers are usually broken up in reducing conditions. However if the interactions between the multimers are strong, the band may appear higher., <br>
  • Q: What is the suggested dilution ratio for Western Blot (WB), Immunohistochemistry (IHC) and or ELISA standards? What is the optimal pH for the sample?
    A: Check the datasheet for the product for details on dilution ratios for different experiments. You can find the datasheet button on the right side of the product page.
  • Q: What is the protocol you used for your Western blotting (WB) and Immunohistochemistry (IHC)?
    A: Check our protocols under the tech support tab.
Copyright © 2019 Boster Biological Technology Inc. All rights reserved.