Click image to see more details
Product Info Summary
| SKU: | PB9296 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Neuropeptide Y/NPY Antibody Picoband®
View all Neuropeptide Y Antibodies
SKU/Catalog Number
PB9296
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Neuropeptide Y/NPY Antibody Picoband® catalog # PB9296. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Neuropeptide Y/NPY Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9296)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9296 is reactive to NPY in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
11 kDa
Calculated molecular weight
10851 MW
Background of Neuropeptide Y
This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9296 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human
Positive Control
IHC: Mouse Brain Tissue, Rat Brain Tissue
Validation Images & Assay Conditions
Click image to see more details
Anti-Neuropeptide Y Picoband antibody, PB9296,IHC(P)
IHC(P): Mouse Brain Tissue
Click image to see more details
Anti-Neuropeptide Y Picoband antibody, PB9296,IHC(P)
IHC(P): Rat Brain Tissue
Click image to see more details
All lanes: Anti Neuropeptide Y (PB9296) at 0.5ug/ml
WB: Recombinant Human Neuropeptide Y Protein 0.5ng
Predicted bind size: 11KD
Observed bind size: 11KD
Protein Target Info & Infographic
Gene/Protein Information For NPY (Source: Uniprot.org, NCBI)
Gene Name
NPY
Full Name
Pro-neuropeptide Y
Weight
10851 MW
Superfamily
NPY family
Alternative Names
Pro-neuropeptide Y;Neuropeptide Y;Neuropeptide tyrosine;NPY;C-flanking peptide of NPY;CPON;NPY; NPY PYY4 neuropeptide Y pro-neuropeptide Y|prepro-neuropeptide Y
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on NPY, check out the NPY Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NPY: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Neuropeptide Y/NPY Antibody Picoband® (PB9296)
Hello CJ!
PB9296 has been cited in 8 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
An immunohistochemical study on endocrine cells in the neuroendocrine system of the digestive tract of milkfish Chanos chanos (Forsskal, 1775)
Increased inflammation promotes ventricular arrhythmia through aggravating left stellate ganglion remodeling in a canine ischemia model
Expression changes of thrombospondin-1 and neuropeptide Y in myocardium of STZ-induced rats
Different Effects of Implanting Sensory Nerve or Blood Vessel on the Vascularization, Neurotization, and Osteogenesis of Tissue-Engineered Bone In Vivo
Wang Sx, Chen Jx, Yue Gx, Bai Mh, Kou Mj, Jin Zy. Evid Based Complement Alternat Med. 2012;2012:381278. Doi: 10.1155/2012/381278. Epub 2012 Nov 13. Xiaoyaosan Decoction Regulates Changes In Neuropeptide Y And Leptin Receptor In The Rat Arcuate Nuc...
Song C, Yang Z, Zhong M, Chen Z. Neural Regen Res. 2013 Feb 25;8(6):506-13. Doi: 10.3969/J.Issn.1673-5374.2013.06.003. Sericin Protects Against Diabetes-Induced Injuries In Sciatic Nerve And Related Nerve Cells.
Wang H, Zhou N, Zhang R, Wu Y, Zhang R, Zhang S. Acta Histochem. 2014 Oct;116(8):1418-26. Doi: 10.1016/J.Acthis.2014.09.005. Epub 2014 Oct 23. Identification And Localization Of Gastrointestinal Hormones In The Skin Of The Bullfrog Rana Catesbeian...
Huang J, Zhu C, Zhang P, Zhu Q, Liu Y, Zhu Z, Wang M, Li W, Yang G, Dong N, Liu J, Chen L, Zhang Y, Yang R, Deng L, Fan J, Wang X, Liu J, Ma B, Fu Q, Wu K. Sci Rep. 2013;3:1114. Doi: 10.1038/Srep01114. Epub 2013 Jan 23. S100+ Cells: A New Neuro-Im...
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Neuropeptide Y/NPY Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Neuropeptide Y/NPY Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
17 Customer Q&As for Anti-Neuropeptide Y/NPY Antibody Picoband®
Question
Do you ship PB9296 with dry ice?
Verified customer
Asked: 2022-05-16
Answer
The Anti-Neuropeptide Y/NPY Antibody Picoband™ (PB9296) does not require dry ice during shipping.
Boster Scientific Support
Answered: 2022-05-16
Question
Would anti-Neuropeptide Y/NPY antibody PB9296 work for IHC with prostate gland?
Verified Customer
Verified customer
Asked: 2019-12-10
Answer
According to the expression profile of prostate gland, NPY is highly expressed in prostate gland. So, it is likely that anti-Neuropeptide Y/NPY antibody PB9296 will work for IHC with prostate gland.
Boster Scientific Support
Answered: 2019-12-10
Question
Can you help my question with product PB9296, anti-Neuropeptide Y/NPY antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-08-09
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9296 anti-Neuropeptide Y/NPY antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-08-09
Question
Is a blocking peptide available for product anti-Neuropeptide Y/NPY antibody (PB9296)?
Verified Customer
Verified customer
Asked: 2019-07-18
Answer
We do provide the blocking peptide for product anti-Neuropeptide Y/NPY antibody (PB9296). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-07-18
Question
We have observed staining in human prostate gland. Any tips? Is anti-Neuropeptide Y/NPY antibody supposed to stain prostate gland positively?
Verified Customer
Verified customer
Asked: 2019-07-11
Answer
According to literature prostate gland does express NPY. According to Uniprot.org, NPY is expressed in prostate gland, brain, liver, among other tissues. Regarding which tissues have NPY expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Liver, Pubmed ID: 24275569
Boster Scientific Support
Answered: 2019-07-11
Question
My lab would like to test anti-Neuropeptide Y/NPY antibody PB9296 on human prostate gland for research purposes, then I may be interested in using anti-Neuropeptide Y/NPY antibody PB9296 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-06-21
Answer
The products we sell, including anti-Neuropeptide Y/NPY antibody PB9296, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-06-21
Question
We are currently using anti-Neuropeptide Y/NPY antibody PB9296 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2019-06-06
Answer
The anti-Neuropeptide Y/NPY antibody (PB9296) has not been validated for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-06-06
Question
Is there a BSA free version of anti-Neuropeptide Y/NPY antibody PB9296 available?
Verified Customer
Verified customer
Asked: 2019-02-01
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Neuropeptide Y/NPY antibody PB9296 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-02-01
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for prostate gland using anti-Neuropeptide Y/NPY antibody PB9296. Let me know if you need anything else.
G. Li
Verified customer
Asked: 2018-07-03
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-07-03
Question
I see that the anti-Neuropeptide Y/NPY antibody PB9296 works with IHC, what is the protocol used to produce the result images on the product page?
E. Collins
Verified customer
Asked: 2018-04-17
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-04-17
Question
Our lab want to know about using your anti-Neuropeptide Y/NPY antibody for g protein-coupled receptor signaling pathway studies. Has this antibody been tested with western blotting on rat brain tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2017-07-26
Answer
We appreciate your inquiry. This PB9296 anti-Neuropeptide Y/NPY antibody is tested on mouse brain, brain tissue, rat brain tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2017-07-26
Question
Our lab were well pleased with the WB result of your anti-Neuropeptide Y/NPY antibody. However we have seen positive staining in liver secreted. using this antibody. Is that expected? Could you tell me where is NPY supposed to be expressed?
Verified Customer
Verified customer
Asked: 2017-06-21
Answer
From what I have seen in literature, liver does express NPY. Generally NPY expresses in secreted. Regarding which tissues have NPY expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Liver, Pubmed ID: 24275569
Boster Scientific Support
Answered: 2017-06-21
Question
See below the WB image, lot number and protocol we used for prostate gland using anti-Neuropeptide Y/NPY antibody PB9296. Please let me know if you require anything else.
C. Moore
Verified customer
Asked: 2016-05-12
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-05-12
Question
We ordered your anti-Neuropeptide Y/NPY antibody for WB on liver in the past. I am using rat, and We want to use the antibody for IHC next. I would like examining liver as well as brain in our next experiment. Do you have any suggestion on which antibody would work the best for IHC?
C. Krishna
Verified customer
Asked: 2015-01-28
Answer
I looked at the website and datasheets of our anti-Neuropeptide Y/NPY antibody and it appears that PB9296 has been tested on rat in both WB and IHC. Thus PB9296 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2015-01-28
Question
Is this PB9296 anti-Neuropeptide Y/NPY antibody reactive to the isotypes of NPY?
B. Mangal
Verified customer
Asked: 2014-11-07
Answer
The immunogen of PB9296 anti-Neuropeptide Y/NPY antibody is A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2014-11-07
Question
I was wanting to use your anti-Neuropeptide Y/NPY antibody for IHC for human prostate gland on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human prostate gland identification?
C. Jones
Verified customer
Asked: 2014-05-20
Answer
As indicated on the product datasheet, PB9296 anti-Neuropeptide Y/NPY antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human prostate gland in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2014-05-20
Question
Would PB9296 anti-Neuropeptide Y/NPY antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
E. Dhar
Verified customer
Asked: 2013-10-23
Answer
As indicated on the product datasheet, PB9296 anti-Neuropeptide Y/NPY antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2013-10-23
