Anti-MMP9 Antibody Picoband®

MMP-9 antibody

Boster Bio Anti-MMP9 Antibody Picoband® catalog # PB9669. Tested in IHC, WB applications. This antibody reacts with Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 100 publication(s).

Product Info Summary

SKU: PB9669
Size: 100 μg/vial
Reactive Species: Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-MMP9 Antibody Picoband®

View all MMP-9 Antibodies

SKU/Catalog Number

PB9669

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-MMP9 Antibody Picoband® catalog # PB9669. Tested in IHC, WB applications. This antibody reacts with Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-MMP9 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9669)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP-9, different from the related human sequence by thirteen amino acids, and from the related rat sequence by eight amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9669 is reactive to Mmp9 in Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

78 kDa

Calculated molecular weight

80535 MW

Background of MMP-9

Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9669 is guaranteed for IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, By Heat
ELISA , 0.1-0.5μg/ml, Mouse, -
Western blot, 0.1-0.5μg/ml, Mouse, Rat

Positive Control

WB: NRK Whole Cell, ANA-1 Whole Cell, HEPA Whole Cell
IHC: mouse kidney tissue, rat liver tissue

Validation Images & Assay Conditions

Gene/Protein Information For Mmp9 (Source: Uniprot.org, NCBI)

Gene Name

Mmp9

Full Name

Matrix metalloproteinase-9

Weight

80535 MW

Superfamily

peptidase M10A family

Alternative Names

Matrix metalloproteinase-9;MMP-9;3.4.24.35;92 kDa gelatinase;92 kDa type IV collagenase;Gelatinase B;GELB;Mmp9;Clg4b; MMP9 CLG4B, GELB, MANDP2, MMP-9 matrix metallopeptidase 9 matrix metalloproteinase-9|macrophage gelatinase|matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)|matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)|type V collagenase

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on Mmp9, check out the Mmp9 Infographic

Mmp9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Mmp9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9669 has been cited in 100 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Inhibition of glioblastoma growth and invasion by 125I brachytherapy in rat glioma model

Fentanyl inhibits the progression of human gastric carcinoma MGC-803 cells by modulating NF-κB-dependent gene expression in vivo

Expression of matrix metalloproteinases‑8 and ‑9 and their tissue inhibitor in the condyles of diabetic rats with mandibular advancement

Effects of electromagnetic pulse exposure on gelatinase of blood–brain barrier in vitro

Rapamycin alleviates brain edema after focal cerebral ischemia reperfusion in rats

Effects of the Traditional Chinese Medicine Dilong on Airway Remodeling in Rats with OVA-induced-Asthma

Zinc Prevents Abdominal Aortic Aneurysm Formation by Induction of A20-Mediated Suppression of NF-κB Pathway

Strontium fructose 1,6‐diphosphate alleviates early diabetic testopathy by suppressing abnormal testicular matrix metalloproteinase system in streptozocin‐treated rats

Effect of Ginkgo biloba extract on experimental cardiac remodeling

Curcumin Administered in Combination with Glu-GNPs Induces Radiosensitivity in Transplanted Tumor MDA-MB-231-luc Cells in Nude Mice

Have you used Anti-MMP9 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-MMP9 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-MMP9 Antibody Picoband®

Question

Is there a BSA free version of anti-MMP9 antibody PB9669 available?

Verified Customer

Verified customer

Asked: 2020-05-07

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-MMP9 antibody PB9669 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-05-07

Question

I am interested in using your anti-MMP9 antibody for positive regulation of dna binding studies. Has this antibody been tested with western blotting on nrk whole cell lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2020-04-13

Answer

Thank you for your inquiry. This PB9669 anti-MMP9 antibody is tested on nrk whole cell lysate, hepa whole cell lysate, mouse kidney tissue, rat liver tissue. It is guaranteed to work for IHC, WB in mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2020-04-13

Question

We have observed staining in mouse umbilical cord blood. Are there any suggestions? Is anti-MMP9 antibody supposed to stain umbilical cord blood positively?

Verified Customer

Verified customer

Asked: 2020-03-27

Answer

From what I have seen in literature umbilical cord blood does express MMP9. From what I have seen in Uniprot.org, MMP9 is expressed in tibia, umbilical cord blood, b-cell, neutrophil, fibrosarcoma, blood, monocytic leukemia, among other tissues. Regarding which tissues have MMP9 expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 15489334
Blood, Pubmed ID: 1480034, 1281792
Fibrosarcoma, Pubmed ID: 1400481, 7669817
Monocytic leukemia, Pubmed ID: 20800577
Neutrophil, Pubmed ID: 1645657, 1464361, 1653055
Umbilical cord blood, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2020-03-27

Question

I see that the anti-MMP9 antibody PB9669 works with WB, what is the protocol used to produce the result images on the product page?

P. Patel

Verified customer

Asked: 2019-11-25

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-11-25

Question

Here is the WB image, lot number and protocol we used for neutrophil using anti-MMP9 antibody PB9669. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-09-17

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-09-17

Question

Would PB9669 anti-MMP9 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

N. Johnson

Verified customer

Asked: 2019-09-16

Answer

You can see on the product datasheet, PB9669 anti-MMP9 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-09-16

Question

My boss were happy with the WB result of your anti-MMP9 antibody. However we have been able to see positive staining in fibrosarcoma extracellular using this antibody. Is that expected? Could you tell me where is MMP9 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-08-23

Answer

According to literature, fibrosarcoma does express MMP9. Generally MMP9 expresses in secreted, extracellular space, extracellular. Regarding which tissues have MMP9 expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 15489334
Blood, Pubmed ID: 1480034, 1281792
Fibrosarcoma, Pubmed ID: 1400481, 7669817
Monocytic leukemia, Pubmed ID: 20800577
Neutrophil, Pubmed ID: 1645657, 1464361, 1653055
Umbilical cord blood, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2019-08-23

Question

Will anti-MMP9 antibody PB9669 work for WB with neutrophil?

Verified Customer

Verified customer

Asked: 2019-07-23

Answer

According to the expression profile of neutrophil, MMP9 is highly expressed in neutrophil. So, it is likely that anti-MMP9 antibody PB9669 will work for WB with neutrophil.

Boster Scientific Support

Answered: 2019-07-23

Question

My question regarding product PB9669, anti-MMP9 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-05-27

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9669 anti-MMP9 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-05-27

Question

We purchased anti-MMP9 antibody for WB on fibrosarcoma a few months ago. I am using rat, and We are going to use the antibody for IHC next. you antibody examining fibrosarcoma as well as tibia in our next experiment. Could you please give me some suggestion on which antibody would work the best for IHC?

Verified Customer

Verified customer

Asked: 2018-09-20

Answer

I took a look at the website and datasheets of our anti-MMP9 antibody and it seems that PB9669 has been validated on rat in both WB and IHC. Thus PB9669 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2018-09-20

Question

We are currently using anti-MMP9 antibody PB9669 for mouse tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it true that the antibody can work on pig tissues as well?

A. Parker

Verified customer

Asked: 2018-05-22

Answer

The anti-MMP9 antibody (PB9669) has not been validated for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-05-22

Question

Is a blocking peptide available for product anti-MMP9 antibody (PB9669)?

Verified Customer

Verified customer

Asked: 2017-11-21

Answer

We do provide the blocking peptide for product anti-MMP9 antibody (PB9669). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2017-11-21

Question

Is this PB9669 anti-MMP9 antibody reactive to the isotypes of MMP9?

E. Wu

Verified customer

Asked: 2017-02-16

Answer

The immunogen of PB9669 anti-MMP9 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP-9 (641-672aa KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF), different from the related human sequence by thirteen amino acids, and from the related rat sequence by eight amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2017-02-16

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for neutrophil using anti-MMP9 antibody PB9669. Let me know if you need anything else.

M. Wu

Verified customer

Asked: 2016-01-29

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-01-29

Question

I am interested in to test anti-MMP9 antibody PB9669 on rat neutrophil for research purposes, then I may be interested in using anti-MMP9 antibody PB9669 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

M. Walker

Verified customer

Asked: 2015-12-24

Answer

The products we sell, including anti-MMP9 antibody PB9669, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2015-12-24

Question

I was wanting to use your anti-MMP9 antibody for WB for rat neutrophil on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat neutrophil identification?

L. Evans

Verified customer

Asked: 2013-11-07

Answer

It shows on the product datasheet, PB9669 anti-MMP9 antibody has been validated for IHC, WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat neutrophil in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2013-11-07

Order DetailsPrice
PB9669

100μg

$370
PB9669-10ug

10μg sample (liquid)

$99
PB9669-Biotin

100 μg Biotin conjugated

$570
PB9669-Cy3

100 μg Cy3 conjugated

$570
PB9669-Dylight488

100 μg Dylight488 conjugated

$570
PB9669-Dylight550

100 μg Dylight550 conjugated

$570
PB9669-Dylight594

100 μg Dylight594 conjugated

$570
PB9669-FITC

100 μg FITC conjugated

$570
PB9669-HRP

100 μg HRP conjugated

$570
PB9669-APC

100 μg APC conjugated

$670
PB9669-PE

100 μg PE conjugated

$670
PB9669-iFluor647

100 μg iFluor647 conjugated

$670
PB9669-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9669
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.