Anti-KChIP2/KCNIP2 Antibody Picoband™

KChIP2 antibody

Boster Bio Anti-KChIP2/KCNIP2 Antibody Picoband™ catalog # PB9652. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9652
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Product Name

Anti-KChIP2/KCNIP2 Antibody Picoband™

View all KChIP2 Antibodies

SKU/Catalog Number

PB9652

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-KChIP2/KCNIP2 Antibody Picoband™ catalog # PB9652. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-KChIP2/KCNIP2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9652)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2, different from the related mouse and rat sequences by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9652 is reactive to KCNIP2 in Human, Mouse, Rat

Applications

PB9652 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Observed Molecular Weight

31 kDa

Calculated molecular weight

30907 MW

Background of KChIP2

Kv channel-interacting protein 2 also known as KChIP2 is a protein that in humans is encoded by the KCNIP2 gene. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. And they are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For KCNIP2 (Source: Uniprot.org, NCBI)

Gene Name

KCNIP2

Full Name

Kv channel-interacting protein 2

Weight

30907 MW

Superfamily

recoverin family

Alternative Names

A-type potassium channel modulatory protein 2; cardiac voltage gated potassium channel modulatory subunit; Cardiac voltage-gated potassium channel modulatory subunit; DKFZp566L1246; KChIP2; KCHIP2Kv channel-interacting protein 2; Kv channel interacting protein 2; MGC17241; potassium channel interacting protein 2; Potassium channel-interacting protein 2 KCNIP2 KCHIP2 potassium voltage-gated channel interacting protein 2 Kv channel-interacting protein 2|A-type potassium channel modulatory protein 2|Kv channel interacting protein 2|cardiac voltage-gated potassium channel modulatory subunit|potassium channel-interacting protein 2

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on KCNIP2, check out the KCNIP2 Infographic

KCNIP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KCNIP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9652

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-KChIP2/KCNIP2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-KChIP2/KCNIP2 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-KChIP2/KCNIP2 Antibody Picoband™

Question

We need to test anti-KChIP2/KCNIP2 antibody PB9652 on rat skeletal muscle for research purposes, then I may be interested in using anti-KChIP2/KCNIP2 antibody PB9652 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

M. Johnson

Verified customer

Asked: 2019-01-03

Answer

The products we sell, including anti-KChIP2/KCNIP2 antibody PB9652, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-01-03

Question

We are currently using anti-KChIP2/KCNIP2 antibody PB9652 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on canine tissues as well?

Verified Customer

Verified customer

Asked: 2018-10-19

Answer

The anti-KChIP2/KCNIP2 antibody (PB9652) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-10-19

Question

Is this PB9652 anti-KChIP2/KCNIP2 antibody reactive to the isotypes of KCNIP2?

P. Rodriguez

Verified customer

Asked: 2018-07-03

Answer

The immunogen of PB9652 anti-KChIP2/KCNIP2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-07-03

Question

I was wanting to use your anti-KChIP2/KCNIP2 antibody for IHC for rat skeletal muscle on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat skeletal muscle identification?

L. Walker

Verified customer

Asked: 2014-10-29

Answer

You can see on the product datasheet, PB9652 anti-KChIP2/KCNIP2 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat skeletal muscle in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2014-10-29

Order DetailsPrice
PB9652

100μg

$370
PB9652-10ug

10μg sample (liquid)

$99
PB9652-Biotin

100 μg Biotin conjugated

$570
PB9652-Cy3

100 μg Cy3 conjugated

$570
PB9652-Dylight488

100 μg Dylight488 conjugated

$570
PB9652-Dylight550

100 μg Dylight550 conjugated

$570
PB9652-Dylight594

100 μg Dylight594 conjugated

$570
PB9652-FITC

100 μg FITC conjugated

$570
PB9652-HRP

100 μg HRP conjugated

$570
PB9652-APC

100 μg APC conjugated

$670
PB9652-PE

100 μg PE conjugated

$670
PB9652-iFluor647

100 μg iFluor647 conjugated

$670
PB9652-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9652
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.