KChIP2 (KCNIP2) (NM_173192) Human Recombinant Protein

KChIP2 protein,

Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 3

Product Info Summary

SKU: PROTQ9NS61
Size: 20 µg
Source: HEK293T

Product Name

KChIP2 (KCNIP2) (NM_173192) Human Recombinant Protein

View all KChIP2 recombinant proteins

SKU/Catalog Number

PROTQ9NS61

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

KChIP2 (KCNIP2) (NM_173192) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NS61)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.8 kDa

Amino Acid Sequence

MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI

Validation Images & Assay Conditions

Gene/Protein Information For KCNIP2 (Source: Uniprot.org, NCBI)

Gene Name

KCNIP2

Full Name

Kv channel-interacting protein 2

Weight

28.8 kDa

Superfamily

recoverin family

Alternative Names

A-type potassium channel modulatory protein 2; cardiac voltage gated potassium channel modulatory subunit; Cardiac voltage-gated potassium channel modulatory subunit; DKFZp566L1246; KChIP2; KCHIP2Kv channel-interacting protein 2; Kv channel interacting protein 2; MGC17241; potassium channel interacting protein 2; Potassium channel-interacting protein 2 KCNIP2 KCHIP2 potassium voltage-gated channel interacting protein 2 Kv channel-interacting protein 2|A-type potassium channel modulatory protein 2|Kv channel interacting protein 2|cardiac voltage-gated potassium channel modulatory subunit|potassium channel-interacting protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KCNIP2, check out the KCNIP2 Infographic

KCNIP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KCNIP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NS61

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used KChIP2 (KCNIP2) (NM_173192) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For KChIP2 (KCNIP2) (NM_173192) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for KChIP2 (KCNIP2) (NM_173192) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NS61
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product