Click image to see more details
Product Info Summary
| SKU: | PB10004 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-ITLN1 Antibody Picoband®
View all Intelectin-1/Omentin Antibodies
SKU/Catalog Number
PB10004
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-ITLN1 Antibody Picoband® catalog # PB10004. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-ITLN1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10004)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ITLN1.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB10004 is reactive to ITLN1 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
43 kDa
Calculated molecular weight
34962 MW
Background of Intelectin-1/Omentin
Intelectin-1, also known as omentin, is an intelectin encoded in humans by the ITLN1 gene. This gene is mapped to chromosome 1q21.3-q22 by genomic sequence analysis. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. Having conserved ligand binding site residues, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB10004 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human
Positive Control
WB: SW620 whole cell
IHC: human intestinal cancer tissue
ICC/IF: U20S cell
FCM: U937 cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of ITLN1 using anti-ITLN1 antibody (PB10004).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: SW620 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ITLN1 antigen affinity purified polyclonal antibody (Catalog # PB10004) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for ITLN1 at approximately 43 kDa. The expected band size for ITLN1 is at 35 kDa.
Click image to see more details
Figure 2. IHC analysis of ITLN1 using anti-ITLN1 antibody (PB10004).
ITLN1 was detected in a paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-ITLN1 Antibody (PB10004) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IF analysis of ITLN1 using anti-ITLN1 antibody (PB10004).
ITLN1 was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-ITLN1 Antibody (PB10004) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 4. Flow Cytometry analysis of U937 cells using anti-ITLN1 antibody (PB10004).
Overlay histogram showing U937 cells stained with PB10004 (Blue line). The cells were fixed with 4% paraformaldehyde and blocked with 10% normal goat serum. And then incubated with rabbit anti-ITLN1 Antibody (PB10004,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For ITLN1 (Source: Uniprot.org, NCBI)
Gene Name
ITLN1
Full Name
Intelectin-1a
Weight
34962 MW
Alternative Names
Intelectin-1;ITLN-1;Endothelial lectin HL-1;Galactofuranose-binding lectin;Intestinal lactoferrin receptor;Omentin;ITLN1;INTL, ITLN, LFR;UNQ640/PRO1270; Itln1|I, IntL, It, Itln, Itln2, Itln3, Itln5, Itlna, Lfr, mL|intelectin 1 (galactofuranose binding)|intelectin-1a|calcium-dependent galactosyl-specific lectin|galactofuranose-binding lectin|intelectin 2|intelectin 5|intelectin a|intestinal lactoferrin receptor|truncated intelectin 3
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ITLN1, check out the ITLN1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ITLN1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-ITLN1 Antibody Picoband® (PB10004)
Hello CJ!
No publications found for PB10004
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-ITLN1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-ITLN1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-ITLN1 Antibody Picoband®
Question
We are currently using anti-ITLN1 antibody PB10004 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on canine tissues as well?
Verified Customer
Verified customer
Asked: 2020-04-09
Answer
The anti-ITLN1 antibody (PB10004) has not been validated for cross reactivity specifically with canine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-04-09
Question
I have a question about product PB10004, anti-ITLN1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-03-23
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10004 anti-ITLN1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-03-23
Question
Please see the WB image, lot number and protocol we used for ovary using anti-ITLN1 antibody PB10004. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-08-19
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-08-19
Question
Is this PB10004 anti-ITLN1 antibody reactive to the isotypes of ITLN1?
Verified Customer
Verified customer
Asked: 2019-06-11
Answer
The immunogen of PB10004 anti-ITLN1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human ITLN1 (19-59aa TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-06-11
Question
We want to test anti-ITLN1 antibody PB10004 on human ovary for research purposes, then I may be interested in using anti-ITLN1 antibody PB10004 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
J. Miller
Verified customer
Asked: 2019-05-24
Answer
The products we sell, including anti-ITLN1 antibody PB10004, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-05-24
Question
Would anti-ITLN1 antibody PB10004 work on horse WB with lung?
Verified Customer
Verified customer
Asked: 2018-12-24
Answer
Our lab technicians have not tested anti-ITLN1 antibody PB10004 on horse. You can run a BLAST between horse and the immunogen sequence of anti-ITLN1 antibody PB10004 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse lung in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-12-24
Question
I see that the anti-ITLN1 antibody PB10004 works with IHC, what is the protocol used to produce the result images on the product page?
C. Wu
Verified customer
Asked: 2014-08-18
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2014-08-18
