Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband®

Hyaluronan synthase 1 antibody

Boster Bio Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband® catalog # A04784-1. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A04784-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC, ICC, WB

Product Name

Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband®

View all Hyaluronan synthase 1 Antibodies

SKU/Catalog Number

A04784-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband® catalog # A04784-1. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04784-1)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Hyaluronan synthase 1/HAS1, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A04784-1 is reactive to HAS1 in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

70 kDa

Calculated molecular weight

64.832kDa

Background of Hyaluronan synthase 1

Hyaluronan synthase 1 is an enzyme that in humans is encoded by the HAS1 gene. This gene is mapped to 19q13.41. Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. AS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and a recently described murine hyaluronan synthase.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A04784-1 is guaranteed for IF, IHC, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml

Positive Control

WB: human SHG-44 whole cell, human THP-1 whole cell, rat brain tissue, rat smooth muscle tissue, rat ovary tissue, mouse brain tissue, mouse smooth muscle tissue, mouse ovary tissue, mouse small intestine tissue, mouse Neuro-2a whole cell
IHC: human lung cancer tissue, human mammary cancer tissue, human mammary cancer tissue, mouse spleen tissue, rat small intestine tissue
ICC/IF: U20S cell, U20S cell

Validation Images & Assay Conditions

Gene/Protein Information For HAS1 (Source: Uniprot.org, NCBI)

Gene Name

HAS1

Full Name

Hyaluronan synthase 1

Weight

64.832kDa

Superfamily

NodC/HAS family

Alternative Names

Hyaluronan synthase 1; Hyaluronate synthase 1; Hyaluronic acid synthase 1; HA synthase 1; HuHAS1; HAS1; HAS HAS1 HAS hyaluronan synthase 1 hyaluronan synthase 1|HA synthase 1|hyaluronate synthase 1|hyaluronic acid synthase 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on HAS1, check out the HAS1 Infographic

HAS1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HAS1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A04784-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

13 Customer Q&As for Anti-Hyaluronan synthase 1/HAS1 Antibody Picoband®

Question

Would A04784-1 anti-Hyaluronan synthase 1/HAS1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-04-24

Answer

As indicated on the product datasheet, A04784-1 anti-Hyaluronan synthase 1/HAS1 antibody as been tested on IHC-P. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-04-24

Question

Is there a BSA free version of anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 available?

Verified Customer

Verified customer

Asked: 2020-04-21

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-04-21

Question

My question regarding product A04784-1, anti-Hyaluronan synthase 1/HAS1 antibody . I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-03-24

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04784-1 anti-Hyaluronan synthase 1/HAS1 antibody , we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-03-24

Question

We are currently using anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 for rat tissue, and we are content with the IHC-P results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on monkey tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-09

Answer

The anti-Hyaluronan synthase 1/HAS1 antibody (A04784-1) has not been tested for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-09

Question

Will anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 work for IHC-P with fetal brain?

Verified Customer

Verified customer

Asked: 2019-12-13

Answer

According to the expression profile of fetal brain, HAS1 is highly expressed in fetal brain. So, it is likely that anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 will work for IHC-P with fetal brain.

Boster Scientific Support

Answered: 2019-12-13

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for fetal brain using anti-Hyaluronan synthase 1/HAS1 antibody A04784-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-09-06

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-09-06

Question

Is a blocking peptide available for product anti-Hyaluronan synthase 1/HAS1 antibody (A04784-1)?

Verified Customer

Verified customer

Asked: 2019-08-19

Answer

We do provide the blocking peptide for product anti-Hyaluronan synthase 1/HAS1 antibody (A04784-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-08-19

Question

I have attached the WB image, lot number and protocol we used for fetal brain using anti-Hyaluronan synthase 1/HAS1 antibody A04784-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-06-25

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-25

Question

Would anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 work on bovine WB with layer of synovial tissue?

Verified Customer

Verified customer

Asked: 2018-10-05

Answer

Our lab technicians have not tested anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine layer of synovial tissue in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-10-05

Question

Is this A04784-1 anti-Hyaluronan synthase 1/HAS1 antibody reactive to the isotypes of HAS1?

Verified Customer

Verified customer

Asked: 2018-07-16

Answer

The immunogen of A04784-1 anti-Hyaluronan synthase 1/HAS1 antibody is A synthetic peptide corresponding to a sequence of human HAS1 (NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-07-16

Question

I was wanting to use your anti-Hyaluronan synthase 1/HAS1 antibody for IHC-P for rat fetal brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat fetal brain identification?

Verified Customer

Verified customer

Asked: 2018-06-06

Answer

You can see on the product datasheet, A04784-1 anti-Hyaluronan synthase 1/HAS1 antibody has been validated for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat fetal brain in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-06-06

Question

I see that the anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 works with IHC-P, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2017-10-17

Answer

You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2017-10-17

Question

We need to test anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 on rat fetal brain for research purposes, then I may be interested in using anti-Hyaluronan synthase 1/HAS1 antibody A04784-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

H. Thomas

Verified customer

Asked: 2015-12-17

Answer

The products we sell, including anti-Hyaluronan synthase 1/HAS1 antibody A04784-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2015-12-17

Order DetailsPrice
A04784-1

100μg

$370
A04784-1-10ug

10μg sample (liquid)

$99
A04784-1-Biotin

100 μg Biotin conjugated

$570
A04784-1-Cy3

100 μg Cy3 conjugated

$570
A04784-1-Dylight488

100 μg Dylight488 conjugated

$570
A04784-1-Dylight550

100 μg Dylight550 conjugated

$570
A04784-1-Dylight594

100 μg Dylight594 conjugated

$570
A04784-1-FITC

100 μg FITC conjugated

$570
A04784-1-HRP

100 μg HRP conjugated

$570
A04784-1-APC

100 μg APC conjugated

$670
A04784-1-PE

100 μg PE conjugated

$670
A04784-1-iFluor647

100 μg iFluor647 conjugated

$670
A04784-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A04784-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product