Click image to see more details
Product Info Summary
| SKU: | A05887-Dyl550 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | Flow Cytometry |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Human BMP5 DyLight® 550 conjugated Antibody
SKU/Catalog Number
A05887-Dyl550
Size
100 μg/vial
Form
Liquid
Description
Boster Bio Anti-Human BMP5 DyLight® 550 conjugated Antibody catalog # A05887-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.
Storage & Handling
At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
Cite This Product
Anti-Human BMP5 DyLight® 550 conjugated Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A05887-Dyl550)
Host
Rabbit
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5, different from the related mouse sequence by three amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A05887-Dyl550 is reactive to BMP5 in Human
Reconstitution
Observed Molecular Weight
39 kDa
Calculated molecular weight
51.737kDa
Background of BMP-5
Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A05887-Dyl550 is guaranteed for Flow Cytometry Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Validation Images & Assay Conditions
Click image to see more details
Boster Kit Box
Protein Target Info & Infographic
Gene/Protein Information For BMP5 (Source: Uniprot.org, NCBI)
Gene Name
BMP5
Full Name
Bone morphogenetic protein 5
Weight
51.737kDa
Superfamily
TGF-beta family
Alternative Names
Bone morphogenetic protein 5; BMP-5; BMP5 BMP5 bone morphogenetic protein 5 bone morphogenetic protein 5
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on BMP5, check out the BMP5 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for BMP5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Human BMP5 DyLight® 550 conjugated Antibody (A05887-Dyl550)
Hello CJ!
No publications found for A05887-Dyl550
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Human BMP5 DyLight® 550 conjugated Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Human BMP5 DyLight® 550 conjugated Antibody
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-Human BMP5 DyLight® 550 conjugated Antibody
Question
Is a blocking peptide available for product anti-Human BMP5 DyLight® 550 conjugated antibody (A05887-Dyl550)?
Verified Customer
Verified customer
Asked: 2020-04-09
Answer
We do provide the blocking peptide for product anti-Human BMP5 DyLight® 550 conjugated antibody (A05887-Dyl550). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-04-09
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for thymus using anti-Human BMP5 DyLight® 550 conjugated antibody A05887-Dyl550. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-03-13
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-03-13
Question
We want to test anti-Human BMP5 DyLight® 550 conjugated antibody A05887-Dyl550 on human thymus for research purposes, then I may be interested in using anti-Human BMP5 DyLight® 550 conjugated antibody A05887-Dyl550 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-02-24
Answer
The products we sell, including anti-Human BMP5 DyLight® 550 conjugated antibody A05887-Dyl550, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-02-24
Question
Does A05887-Dyl550 anti-Human BMP5 DyLight® 550 conjugated antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-09-05
Answer
It shows on the product datasheet, A05887-Dyl550 anti-Human BMP5 DyLight® 550 conjugated antibody as been tested on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-09-05
Question
I have a question about product A05887-Dyl550, anti-Human BMP5 DyLight® 550 conjugated antibody . I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-07-18
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A05887-Dyl550 anti-Human BMP5 DyLight® 550 conjugated antibody , we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-07-18
Question
Is this A05887-Dyl550 anti-Human BMP5 DyLight® 550 conjugated antibody reactive to the isotypes of BMP5?
Verified Customer
Verified customer
Asked: 2017-09-05
Answer
The immunogen of A05887-Dyl550 anti-Human BMP5 DyLight® 550 conjugated antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2017-09-05
Question
Please see the WB image, lot number and protocol we used for thymus using anti-Human BMP5 DyLight® 550 conjugated antibody A05887-Dyl550. Please let me know if you require anything else.
J. Li
Verified customer
Asked: 2017-05-18
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-05-18
