Anti-HMGB1 Antibody Picoband®

HMGB1/HMG-1 antibody

Boster Bio Anti-HMGB1 Antibody Picoband® catalog # A00066-1. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 11 publication(s).

Product Info Summary

SKU: A00066-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-HMGB1 Antibody Picoband®

View all HMGB1/HMG-1 Antibodies

SKU/Catalog Number

A00066-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-HMGB1 Antibody Picoband® catalog # A00066-1. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-HMGB1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00066-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

A00066-1 is reactive to HMGB1 in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

25 kDa

Calculated molecular weight

24894 MW

Background of HMGB1/HMG-1

High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00066-1 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: human Hela whole cell, human 293T whole cell, human K562 whole cell, human Jurkat whole cell, rat brain tissue, mouse brain tissue, mouse RAW264.7 whole cell
IHC: mouse intestine tissue, mouse liver tissue, rat intestine tissue, rat liver tissue, human mammary cancer tissue, human placenta tissue,
ICC/IF: U20S cell, A431 cell
FCM: THP-1 cell

Validation Images & Assay Conditions

Gene/Protein Information For HMGB1 (Source: Uniprot.org, NCBI)

Gene Name

HMGB1

Full Name

High mobility group protein B1

Weight

24894 MW

Superfamily

HMGB family

Alternative Names

High mobility group protein B1;High mobility group protein 1;HMG-1;HMGB1;HMG1; HMGB1 HMG-1, HMG1, HMG3, SBP-1 high mobility group box 1 high mobility group protein B1|Amphoterin|Sulfoglucuronyl carbohydrate binding protein|high-mobility group (nonhistone chromosomal) protein 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on HMGB1, check out the HMGB1 Infographic

HMGB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HMGB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A00066-1 has been cited in 11 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Association of Upregulated HMGB1 and c-IAP2 Proteins With Hepatocellular Carcinoma Development and Progression

Extracellular HMGB1 blockade inhibits tumor growth through profoundly remodeling immune microenvironment and enhances checkpoint inhibitor-based immunotherapy

Effects of Ethyl Pyruvate in Preventing the Development of Diet-induced Atherosclerosis by Blocking the HMGB1 Expression in ApoE-Deficient Mice

Hubert P,Roncarati P, Demoulin S, Pilard C, Ancion M, Reynders C, Lerho T, Bruyere D, Lebeau A, Radermecker C, Meunier M, Nokin MJ, Hendrick E, Peulen O, Delvenne P, Herfs M. Extracellular HMGB1 blockade inhibits tumor growth through profoundly remodeling immune microenvironment and enhances checkpoint inhibitor-based immunotherapy. J Immunother Cancer. 2021 Mar;9(3):e001966. doi: 10.1136/jitc-2020-001966. PMID: 33712445.
Species: Human,Mouse
A00066-1 usage in article: APP:WB, SAMPLE:MOUSE BREAST CANCER CELLS, DILUTION:1:1000

Wen Y,Sun HY,Tan Z,Liu RH,Huang SQ,Chen GY,Qi H,Tang LJ.Abdominal paracentesis drainage ameliorates myocardial injury in severe experimental pancreatitis rats through suppressing oxidative stress.World J Gastroenterol.2020 Jan 7;26(1):35-54.doi:10.3748/wj
Species: Rat
A00066-1 usage in article: APP:WB, SAMPLE:PAAF CELLS, DILUTION:NA

MicroRNA-205%u20115b inhibits HMGB1 expression in LPS-induced sepsis

Propofol inhibits the release of interleukin-6, 8 and tumor necrosis factor-? correlating with high-mobility group box 1 expression in lipopolysaccharides-stimulated RAW 264.7 cells

Galantamine protects against lipopolysaccharide-induced acute lung injury in rats

The Protective Role of Interleukin-33 in Myocardial Ischemia and Reperfusion Is Associated with Decreased HMGB1 Expression and Up-Regulation of the P38 MAPK Signaling Pathway

Association of Upregulated HMGB1 and c-IAP2 Proteins With Hepatocellular Carcinoma Development and Progression

Have you used Anti-HMGB1 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-HMGB1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

17 Customer Q&As for Anti-HMGB1 Antibody Picoband®

Question

What tissue is recommend as a positive control for A00066-1?

Verified customer

Asked: 2021-01-13

Answer

For the Anti-HMGB1 Antibody Picoband™ (A00066-1), the following tissue can be used as positive controls in IHC; mouse intestine mouse liver rat intestine rat liver human mammary cancer human placenta Our lab tested these tissue samples and observed positive signal. https://www.bosterbio.com/anti-hmgb1-picoband-trade-antibody-a00066-1-boster.html#product-image-1

Boster Scientific Support

Answered: 2021-01-14

Question

I see that the anti-HMGB1 antibody A00066-1 works with WB, what is the protocol used to produce the result images on the product page?

J. Dhar

Verified customer

Asked: 2020-03-19

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-03-19

Question

Do you have a BSA free version of anti-HMGB1 antibody A00066-1 available?

Verified Customer

Verified customer

Asked: 2019-12-10

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-HMGB1 antibody A00066-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-12-10

Question

We are currently using anti-HMGB1 antibody A00066-1 for human tissue, and we are well pleased with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on monkey tissues as well?

Verified Customer

Verified customer

Asked: 2019-11-28

Answer

The anti-HMGB1 antibody (A00066-1) has not been tested for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-11-28

Question

Our lab were content with the WB result of your anti-HMGB1 antibody. However we have been able to see positive staining in liver nucleus using this antibody. Is that expected? Could you tell me where is HMGB1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-07-03

Answer

According to literature, liver does express HMGB1. Generally HMGB1 expresses in nucleus. Regarding which tissues have HMGB1 expression, here are a few articles citing expression in various tissues:
Brain, Cervix, and Testis, Pubmed ID: 15489334
Cerebellum, Pubmed ID: 14702039
Cervix carcinoma, Pubmed ID: 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Liver, Pubmed ID: 24275569
Mammary carcinoma, Pubmed ID: 9150946
Small intestine, Pubmed ID: 17974005

Boster Scientific Support

Answered: 2019-07-03

Question

I am interested in to test anti-HMGB1 antibody A00066-1 on mouse small intestine for research purposes, then I may be interested in using anti-HMGB1 antibody A00066-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

D. Walker

Verified customer

Asked: 2019-05-03

Answer

The products we sell, including anti-HMGB1 antibody A00066-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-05-03

Question

Is a blocking peptide available for product anti-HMGB1 antibody (A00066-1)?

V. Parker

Verified customer

Asked: 2019-04-22

Answer

We do provide the blocking peptide for product anti-HMGB1 antibody (A00066-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-04-22

Question

Would A00066-1 anti-HMGB1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2018-12-18

Answer

You can see on the product datasheet, A00066-1 anti-HMGB1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-12-18

Question

We have been able to see staining in mouse small intestine. Any tips? Is anti-HMGB1 antibody supposed to stain small intestine positively?

Verified Customer

Verified customer

Asked: 2018-09-24

Answer

According to literature small intestine does express HMGB1. According to Uniprot.org, HMGB1 is expressed in kidney, cerebellum, small intestine, brain, cervix testis, mammary carcinoma, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have HMGB1 expression, here are a few articles citing expression in various tissues:
Brain, Cervix, and Testis, Pubmed ID: 15489334
Cerebellum, Pubmed ID: 14702039
Cervix carcinoma, Pubmed ID: 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Liver, Pubmed ID: 24275569
Mammary carcinoma, Pubmed ID: 9150946
Small intestine, Pubmed ID: 17974005

Boster Scientific Support

Answered: 2018-09-24

Question

Would anti-HMGB1 antibody A00066-1 work for WB with small intestine?

Verified Customer

Verified customer

Asked: 2017-10-30

Answer

According to the expression profile of small intestine, HMGB1 is highly expressed in small intestine. So, it is likely that anti-HMGB1 antibody A00066-1 will work for WB with small intestine.

Boster Scientific Support

Answered: 2017-10-30

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for small intestine using anti-HMGB1 antibody A00066-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2017-09-26

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-09-26

Question

We are interested in using your anti-HMGB1 antibody for negative regulation of rna polymerase ii transcriptional preinitiation complex assembly studies. Has this antibody been tested with western blotting on mouse liver? We would like to see some validation images before ordering.

V. Anderson

Verified customer

Asked: 2017-09-18

Answer

Thank you for your inquiry. This A00066-1 anti-HMGB1 antibody is validated on mouse liver, 22rv1 whole cell lysates, hela whole cell lysates. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2017-09-18

Question

Here is the WB image, lot number and protocol we used for small intestine using anti-HMGB1 antibody A00066-1. Please let me know if you require anything else.

K. Singh

Verified customer

Asked: 2016-12-28

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-12-28

Question

Is this A00066-1 anti-HMGB1 antibody reactive to the isotypes of HMGB1?

K. Moore

Verified customer

Asked: 2016-07-04

Answer

The immunogen of A00066-1 anti-HMGB1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2016-07-04

Question

I was wanting to use your anti-HMGB1 antibody for WB for mouse small intestine on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse small intestine identification?

E. Krishna

Verified customer

Asked: 2015-10-27

Answer

It shows on the product datasheet, A00066-1 anti-HMGB1 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse small intestine in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2015-10-27

Question

We have tried in the past anti-HMGB1 antibody for IHC on liver in a previous project. I am using rat, and We want to use the antibody for WB next. We need examining liver as well as cervix testis in our next experiment. Do you have any suggestion on which antibody would work the best for WB?

V. Carter

Verified customer

Asked: 2015-08-28

Answer

I looked at the website and datasheets of our anti-HMGB1 antibody and I see that A00066-1 has been tested on rat in both IHC and WB. Thus A00066-1 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2015-08-28

Question

I have a question about product A00066-1, anti-HMGB1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

L. Edwards

Verified customer

Asked: 2014-05-29

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00066-1 anti-HMGB1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2014-05-29

Order DetailsPrice
A00066-1

100μg

$370
A00066-1-10ug

10μg sample (liquid)

$99
A00066-1-Biotin

100 μg Biotin conjugated

$570
A00066-1-Cy3

100 μg Cy3 conjugated

$570
A00066-1-Dylight488

100 μg Dylight488 conjugated

$570
A00066-1-Dylight550

100 μg Dylight550 conjugated

$570
A00066-1-Dylight594

100 μg Dylight594 conjugated

$570
A00066-1-FITC

100 μg FITC conjugated

$570
A00066-1-HRP

100 μg HRP conjugated

$570
A00066-1-APC

100 μg APC conjugated

$670
A00066-1-PE

100 μg PE conjugated

$670
A00066-1-iFluor647

100 μg iFluor647 conjugated

$670
A00066-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00066-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.