Click image to see more details
Product Info Summary
| SKU: | PB9709 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-GRK6 Antibody Picoband®
SKU/Catalog Number
PB9709
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-GRK6 Antibody Picoband® catalog # PB9709. Tested in WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-GRK6 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9709)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human GRK6, different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9709 is reactive to GRK6 in Human, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
66 kDa
Calculated molecular weight
65991 MW
Background of GRK6
G protein-coupled receptor kinase 6 is an enzyme that in humans is encoded by the GRK6 gene. It is mapped to 5q35. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. Also, GRK6 appears to be involved in responses to morphine.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9709 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Rat
Positive Control
WB: Rat Lung Tissue, HELA Whole Cell, K562 Whole Cell, JURKAT Whole Cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of GRK6 using anti-GRK6 antibody (PB9709).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: Rat Lung Tissue Lysate at 50ug,
Lane 2: HELA Whole Cell Lysate at 40ug,
Lane 3: K562 Whole Cell Lysate at 40ug,
Lane 4: JURKAT Whole Cell Lysate at 40ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GRK6 antigen affinity purified polyclonal antibody (Catalog # PB9709) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for GRK6 at approximately 66 kDa. The expected band size for GRK6 is at 66 kDa.
Protein Target Info & Infographic
Gene/Protein Information For GRK6 (Source: Uniprot.org, NCBI)
Gene Name
GRK6
Full Name
G protein-coupled receptor kinase 6
Weight
65991 MW
Superfamily
protein kinase superfamily
Alternative Names
G protein-coupled receptor kinase 6;2.7.11.16;G protein-coupled receptor kinase GRK6;GRK6;GPRK6; GRK6 GPRK6 G protein-coupled receptor kinase 6 G protein-coupled receptor kinase 6
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on GRK6, check out the GRK6 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for GRK6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-GRK6 Antibody Picoband® (PB9709)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-GRK6 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-GRK6 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-GRK6 Antibody Picoband®
Question
Would PB9709 anti-GRK6 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-05-01
Answer
You can see on the product datasheet, PB9709 anti-GRK6 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-05-01
Question
We are currently using anti-GRK6 antibody PB9709 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, rat. Is it likely that the antibody can work on pig tissues as well?
Verified Customer
Verified customer
Asked: 2020-03-05
Answer
The anti-GRK6 antibody (PB9709) has not been tested for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-03-05
Question
See below the WB image, lot number and protocol we used for uterus using anti-GRK6 antibody PB9709. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-12-30
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-12-30
Question
My question regarding product PB9709, anti-GRK6 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
G. Anderson
Verified customer
Asked: 2019-08-13
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9709 anti-GRK6 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-08-13
Question
Is this PB9709 anti-GRK6 antibody reactive to the isotypes of GRK6?
Verified Customer
Verified customer
Asked: 2018-06-19
Answer
The immunogen of PB9709 anti-GRK6 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human GRK6 (382-417aa QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-06-19
