Anti-GRK6 Antibody Picoband™

GRK6 antibody

Boster Bio Anti-GRK6 Antibody Picoband™ catalog # PB9709. Tested in WB applications. This antibody reacts with Human, Rat.

Product Info Summary

SKU: PB9709
Size: 100 μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: WB

Product Name

Anti-GRK6 Antibody Picoband™

View all GRK6 Antibodies

SKU/Catalog Number

PB9709

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-GRK6 Antibody Picoband™ catalog # PB9709. Tested in WB applications. This antibody reacts with Human, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-GRK6 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9709)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human GRK6, different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9709 is reactive to GRK6 in Human, Rat

Applications

PB9709 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

66 kDa

Calculated molecular weight

65991 MW

Background of GRK6

G protein-coupled receptor kinase 6 is an enzyme that in humans is encoded by the GRK6 gene. It is mapped to 5q35. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. Also, GRK6 appears to be involved in responses to morphine.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Rat

Validation Images & Assay Conditions

Gene/Protein Information For GRK6 (Source: Uniprot.org, NCBI)

Gene Name

GRK6

Full Name

G protein-coupled receptor kinase 6

Weight

65991 MW

Superfamily

protein kinase superfamily

Alternative Names

EC 2.7.11; EC 2.7.11.16; FLJ32135; G protein-coupled receptor kinase 6; GPRK6G protein-coupled receptor kinase GRK6 GRK6 GPRK6 G protein-coupled receptor kinase 6 G protein-coupled receptor kinase 6

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on GRK6, check out the GRK6 Infographic

GRK6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GRK6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9709

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-GRK6 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-GRK6 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-GRK6 Antibody Picoband™

Question

Would PB9709 anti-GRK6 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-05-01

Answer

You can see on the product datasheet, PB9709 anti-GRK6 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-05-01

Question

We are currently using anti-GRK6 antibody PB9709 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, rat. Is it likely that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2020-03-05

Answer

The anti-GRK6 antibody (PB9709) has not been tested for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-03-05

Question

See below the WB image, lot number and protocol we used for uterus using anti-GRK6 antibody PB9709. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-12-30

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-12-30

Question

My question regarding product PB9709, anti-GRK6 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

G. Anderson

Verified customer

Asked: 2019-08-13

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9709 anti-GRK6 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-08-13

Question

Is this PB9709 anti-GRK6 antibody reactive to the isotypes of GRK6?

Verified Customer

Verified customer

Asked: 2018-06-19

Answer

The immunogen of PB9709 anti-GRK6 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human GRK6 (382-417aa QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-06-19

Order DetailsPrice
PB9709

100μg

$370
PB9709-10ug

10μg sample (liquid)

$99
PB9709-Biotin

100 μg Biotin conjugated

$570
PB9709-Cy3

100 μg Cy3 conjugated

$570
PB9709-Dylight488

100 μg Dylight488 conjugated

$570
PB9709-Dylight550

100 μg Dylight550 conjugated

$570
PB9709-Dylight594

100 μg Dylight594 conjugated

$570
PB9709-FITC

100 μg FITC conjugated

$570
PB9709-HRP

100 μg HRP conjugated

$570
PB9709-APC

100 μg APC conjugated

$670
PB9709-PE

100 μg PE conjugated

$670
PB9709-iFluor647

100 μg iFluor647 conjugated

$670
PB9709-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9709
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.