Click image to see more details
Product Info Summary
| SKU: | A01135 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Galactosidase alpha/Gla Antibody Picoband®
View all alpha-Galactosidase A/GLA Antibodies
SKU/Catalog Number
A01135
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Galactosidase alpha/Gla Antibody Picoband® catalog # A01135. Tested in WB applications. This antibody reacts with Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Galactosidase alpha/Gla Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01135)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla, different from the related human sequence by fifteen amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01135 is reactive to Gla in Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
49 kDa
Calculated molecular weight
47643 MW
Background of alpha-Galactosidase A/GLA
Alpha-galactosidase is a glycoside hydrolase enzyme that encoded by the GLA gene. This gene is a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A01135 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Mouse, Rat
Positive Control
WB: rat liver tissue, rat brain tissue, rat C6 whole cell, mouse liver tissue, mouse brain tissue, mouse NIH/3T3 whole cell, rat brain tissue, mouse brain tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Gla using anti-Gla antibody (A01135).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat liver tissue lysates,
Lane 2: rat brain tissue lysates,
Lane 3: rat C6 whole cell lysates,
Lane 4: mouse liver tissue lysates,
Lane 5: mouse brain tissue lysates,
Lane 6: mouse NIH/3T3 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Gla antigen affinity purified polyclonal antibody (Catalog # A01135) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Gla at approximately 49 kDa. The expected band size for Gla is at 49 kDa.
Click image to see more details
Figure 2. Western blot analysis of Gla using anti-Gla antibody (A01135).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat brain tissue lysates,
Lane 2: rat C6 whole cell lysates,
Lane 3: mouse brain tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Gla antigen affinity purified polyclonal antibody (A01135) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-DyLight 647 Conjugated secondary antibody at a dilution of 1:2000 for 1.5 hour at RT. A specific band was detected for Gla at approximately 49 kDa. The expected band size for Gla is at 49 kDa.
Protein Target Info & Infographic
Gene/Protein Information For Gla (Source: Uniprot.org, NCBI)
Gene Name
Gla
Full Name
Alpha-galactosidase A
Weight
47643 MW
Superfamily
glycosyl hydrolase 27 family
Alternative Names
Alpha-galactosidase A;3.2.1.22 ;Alpha-D-galactosidase A;Alpha-D-galactoside galactohydrolase;Melibiase;Gla;Ags; GLA GALA galactosidase alpha alpha-galactosidase A|agalsidase alfa|alpha-D-galactosidase A|alpha-D-galactoside galactohydrolase 1|alpha-gal A|galactosylgalactosylglucosylceramidase GLA|melibiase
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on Gla, check out the Gla Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Gla: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Galactosidase alpha/Gla Antibody Picoband® (A01135)
Hello CJ!
No publications found for A01135
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Galactosidase alpha/Gla Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Galactosidase alpha/Gla Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-Galactosidase alpha/Gla Antibody Picoband®
Question
Is this A01135 anti-Galactosidase alpha/Gla antibody reactive to the isotypes of GLA?
Verified Customer
Verified customer
Asked: 2019-07-26
Answer
The immunogen of A01135 anti-Galactosidase alpha/Gla antibody is A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218-275aa DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA), different from the related human sequence by fifteen amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-07-26
Question
Does anti-Galactosidase alpha/Gla antibody A01135 work on dog WB with left adrenal gland?
Verified Customer
Verified customer
Asked: 2019-06-10
Answer
Our lab technicians have not tested anti-Galactosidase alpha/Gla antibody A01135 on dog. You can run a BLAST between dog and the immunogen sequence of anti-Galactosidase alpha/Gla antibody A01135 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated dog samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in dog left adrenal gland in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-06-10
Question
Will A01135 anti-Galactosidase alpha/Gla antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2018-02-12
Answer
As indicated on the product datasheet, A01135 anti-Galactosidase alpha/Gla antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-02-12
Question
We are currently using anti-Galactosidase alpha/Gla antibody A01135 for mouse tissue, and we are content with the WB results. The species of reactivity given in the datasheet says mouse. Is it true that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2018-01-05
Answer
The anti-Galactosidase alpha/Gla antibody (A01135) has not been validated for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-01-05
Question
I see that the anti-Galactosidase alpha/Gla antibody A01135 works with WB, what is the protocol used to produce the result images on the product page?
B. Carter
Verified customer
Asked: 2017-10-31
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2017-10-31
