Click image to see more details
Product Info Summary
| SKU: | A00098 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-FGFR1 Antibody Picoband®
SKU/Catalog Number
A00098
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-FGFR1 Antibody Picoband® catalog # A00098. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-FGFR1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00098)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human FGFR1, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00098 is reactive to FGFR1 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
100 kDa
Calculated molecular weight
91868 MW
Background of FGFR1
FGFR1, Fibroblast growth factor receptor 1, also known as basic fibroblast growth factor receptor 1, fms-related tyrosine kinase-2 / Pfeiffer syndrome, and CD331, is a receptor tyrosine kinase whose ligands are specific members of the fibroblast growth factor family. The FGFR1 gene is localized to 8p12-p11.2 by in situ hybridization. FGFR1 is essential for the normal formation of the organ of Corti and that phenotype severity observed in FGFR1 mutants is dependent on the dose of FGFR1. Mutations in this gene have been associated with Pfeiffer syndrome, Jackson-Weiss syndrome, Antley-Bixler syndrome, osteoglophonic dysplasia, squamous cell lung cancer and autosomal dominant Kallmann syndrome 2.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00098 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Positive Control
WB: HEPG2 whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of FGFR1 using anti-FGFR1 antibody (A00098).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: HEPG2 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-FGFR1 antigen affinity purified polyclonal antibody (Catalog # A00098) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for FGFR1 at approximately 100KD. The expected band size for FGFR1 is at 91KD.
Protein Target Info & Infographic
Gene/Protein Information For FGFR1 (Source: Uniprot.org, NCBI)
Gene Name
FGFR1
Full Name
Fibroblast growth factor receptor 1
Weight
91868 MW
Superfamily
protein kinase superfamily
Alternative Names
Fibroblast growth factor receptor 1;FGFR-1;2.7.10.1;Basic fibroblast growth factor receptor 1;BFGFR;bFGF-R-1;Fms-like tyrosine kinase 2;FLT-2;N-sam;Proto-oncogene c-Fgr;CD331;FGFR1;BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR; FGFR1 BFGFR, CD331, CEK, ECCL, FGFBR, FGFR-1, FLG, FLT-2, FLT2, HBGFR, HH2, HRTFDS, KAL2, N-SAM, OGD, bFGF-R-1 fibroblast growth factor receptor 1 fibroblast growth factor receptor 1|FGFR1/PLAG1 fusion|FMS-like tyrosine kinase 2|basic fibroblast growth factor receptor 1|fms-related tyrosine kinase 2|heparin-binding growth factor receptor|hydroxyaryl-protein kinase|proto-oncogene c-Fgr
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on FGFR1, check out the FGFR1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FGFR1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-FGFR1 Antibody Picoband® (A00098)
Hello CJ!
A00098 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Expression of fibroblast growth factor 9 and its receptors in the dentate gyrus of hippocampus in poststroke depression rats
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-FGFR1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-FGFR1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-FGFR1 Antibody Picoband®
Question
I see that the anti-FGFR1 antibody A00098 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2020-04-22
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-04-22
Question
We have seen staining in human placenta testis. Are there any suggestions? Is anti-FGFR1 antibody supposed to stain placenta testis positively?
Verified Customer
Verified customer
Asked: 2020-01-10
Answer
According to literature placenta testis does express FGFR1. According to Uniprot.org, FGFR1 is expressed in body of pancreas, placenta, neonatal brain stem, teratocarcinoma, lung, liver, placenta testis, brain colon, pancreas, testis uterus, foreskin fibroblast umbilical vein, plasma, among other tissues. Regarding which tissues have FGFR1 expression, here are a few articles citing expression in various tissues:
Brain, and Colon, Pubmed ID: 16421571
Foreskin fibroblast, and Umbilical vein, Pubmed ID: 1652059
Liver, Pubmed ID: 1846977
Lung, Pubmed ID: 1650441
Neonatal brain stem, Pubmed ID: 1697263
Pancreas, Testis, and Uterus, Pubmed ID: 15489334
Placenta, Pubmed ID: 2159626, 2162671
Placenta, and Testis, Pubmed ID: 14702039
Plasma, Pubmed ID: 16335952
Teratocarcinoma, Pubmed ID: 1722683
Boster Scientific Support
Answered: 2020-01-10
Question
Does A00098 anti-FGFR1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-09-17
Answer
You can see on the product datasheet, A00098 anti-FGFR1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-09-17
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung using anti-FGFR1 antibody A00098. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-08-23
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-08-23
Question
My team were happy with the WB result of your anti-FGFR1 antibody. However we have been able to see positive staining in placenta testis cell membrane using this antibody. Is that expected? Could you tell me where is FGFR1 supposed to be expressed?
N. Jha
Verified customer
Asked: 2019-06-14
Answer
According to literature, placenta testis does express FGFR1. Generally FGFR1 expresses in cell membrane. Regarding which tissues have FGFR1 expression, here are a few articles citing expression in various tissues:
Brain, and Colon, Pubmed ID: 16421571
Foreskin fibroblast, and Umbilical vein, Pubmed ID: 1652059
Liver, Pubmed ID: 1846977
Lung, Pubmed ID: 1650441
Neonatal brain stem, Pubmed ID: 1697263
Pancreas, Testis, and Uterus, Pubmed ID: 15489334
Placenta, Pubmed ID: 2159626, 2162671
Placenta, and Testis, Pubmed ID: 14702039
Plasma, Pubmed ID: 16335952
Teratocarcinoma, Pubmed ID: 1722683
Boster Scientific Support
Answered: 2019-06-14
Question
Is a blocking peptide available for product anti-FGFR1 antibody (A00098)?
Verified Customer
Verified customer
Asked: 2019-05-24
Answer
We do provide the blocking peptide for product anti-FGFR1 antibody (A00098). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-05-24
Question
We are currently using anti-FGFR1 antibody A00098 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on primate tissues as well?
C. Mitchell
Verified customer
Asked: 2019-03-18
Answer
The anti-FGFR1 antibody (A00098) has not been tested for cross reactivity specifically with primate tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-03-18
Question
I am interested in using your anti-FGFR1 antibody for positive regulation of neuron projection development studies. Has this antibody been tested with western blotting on hepg2 whole cell lysates? We would like to see some validation images before ordering.
P. Singh
Verified customer
Asked: 2019-03-11
Answer
We appreciate your inquiry. This A00098 anti-FGFR1 antibody is tested on hepg2 whole cell lysates. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-03-11
Question
See below the WB image, lot number and protocol we used for lung using anti-FGFR1 antibody A00098. Please let me know if you require anything else.
D. Moore
Verified customer
Asked: 2019-01-09
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-01-09
Question
Would anti-FGFR1 antibody A00098 work for WB with lung?
N. Collins
Verified customer
Asked: 2018-12-17
Answer
According to the expression profile of lung, FGFR1 is highly expressed in lung. So, it is likely that anti-FGFR1 antibody A00098 will work for WB with lung.
Boster Scientific Support
Answered: 2018-12-17
Question
Is there a BSA free version of anti-FGFR1 antibody A00098 available?
J. Dhar
Verified customer
Asked: 2018-07-05
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-FGFR1 antibody A00098 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-07-05
Question
Is this A00098 anti-FGFR1 antibody reactive to the isotypes of FGFR1?
Verified Customer
Verified customer
Asked: 2018-05-17
Answer
The immunogen of A00098 anti-FGFR1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human FGFR1 (489-520aa FGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDA), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-05-17
Question
I was wanting to use your anti-FGFR1 antibody for WB for human lung on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human lung identification?
E. Li
Verified customer
Asked: 2015-10-06
Answer
You can see on the product datasheet, A00098 anti-FGFR1 antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human lung in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2015-10-06
Question
I am interested in to test anti-FGFR1 antibody A00098 on human lung for research purposes, then I may be interested in using anti-FGFR1 antibody A00098 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
J. Yang
Verified customer
Asked: 2015-02-04
Answer
The products we sell, including anti-FGFR1 antibody A00098, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2015-02-04
Question
My question regarding product A00098, anti-FGFR1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
T. Edwards
Verified customer
Asked: 2013-04-15
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00098 anti-FGFR1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2013-04-15
