Product Info Summary
SKU: | A00931-2 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-ETS1 Antibody Picoband™
SKU/Catalog Number
A00931-2
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-ETS1 Antibody Picoband™ catalog # A00931-2. Tested in WB applications. This antibody reacts with Human, Mouse.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-ETS1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00931-2)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ETS1, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00931-2 is reactive to ETS1 in Human, Mouse
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
54 kDa
Calculated molecular weight
50408 MW
Background of Ets-1
Protein C-ets-1 is a protein that in humans is encoded by the ETS1 gene. It is mapped to 11q24.3. This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00931-2 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse
Positive Control
Validation Images & Assay Conditions
![a00931 2 1_1 a00931 2 1_1](https://www.bosterbio.com/media/catalog/product/a/0/a00931-2-1_1.jpg)
Click image to see more details
Figure 1. Western blot analysis of ETS1 using anti-ETS1 antibody (A00931-2).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: NIH3T3 whole Cell lysates,
Lane 2: A375 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ETS1 antigen affinity purified polyclonal antibody (Catalog # A00931-2) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for ETS1 at approximately 54KD. The expected band size for ETS1 is at 54KD.
Protein Target Info & Infographic
Gene/Protein Information For ETS1 (Source: Uniprot.org, NCBI)
Gene Name
ETS1
Full Name
Protein C-ets-1
Weight
50408 MW
Superfamily
ETS family
Alternative Names
Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1; ets protein; Ets1; Ets-1; EWSR2; FLJ10768; p54; Protein C-Ets-1; v-ets avian erythroblastosis virus E2 oncogene homolog 1; v-ets avian erythroblastosis virus E26 oncogene homolog 1; v-ets erythroblastosis virus E26 oncogene homolog 1 (avian); v-ets ETS1 ETS-1, EWSR2, c-ets-1, p54 ETS proto-oncogene 1, transcription factor protein C-ets-1|Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1|v-ets avian erythroblastosis virus E2 oncogene homolog 1|v-ets avian erythroblastosis virus E26 oncogene homolog 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ETS1, check out the ETS1 Infographic
![ETS1 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ETS1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-ETS1 Antibody Picoband™ (A00931-2)
Hello CJ!
A00931-2 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Luteolin Inhibits Ischemia/Reperfusion-Induced Myocardial Injury in Rats via Downregulation of microRNA-208b-3p
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-ETS1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-ETS1 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-ETS1 Antibody Picoband™
Question
My colleagues were happy with the WB result of your anti-ETS1 antibody. However we have observed positive staining in blood cytoplasm. using this antibody. Is that expected? Could you tell me where is ETS1 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-04-02
Answer
According to literature, blood does express ETS1. Generally ETS1 expresses in cytoplasm. Regarding which tissues have ETS1 expression, here are a few articles citing expression in various tissues:
Endometrium, Pubmed ID: 17974005
Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 19690332
Lung, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2020-04-02
Question
I see that the anti-ETS1 antibody A00931-2 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2020-03-17
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-03-17
Question
Is a blocking peptide available for product anti-ETS1 antibody (A00931-2)?
Verified Customer
Verified customer
Asked: 2019-12-09
Answer
We do provide the blocking peptide for product anti-ETS1 antibody (A00931-2). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-12-09
Question
Please see the WB image, lot number and protocol we used for blood using anti-ETS1 antibody A00931-2. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-10-24
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-10-24
Question
We have seen staining in mouse endometrium. Are there any suggestions? Is anti-ETS1 antibody supposed to stain endometrium positively?
Verified Customer
Verified customer
Asked: 2019-10-01
Answer
Based on literature endometrium does express ETS1. Based on Uniprot.org, ETS1 is expressed in blood, endometrium, lung, leukemic t-cell, erythroleukemia, among other tissues. Regarding which tissues have ETS1 expression, here are a few articles citing expression in various tissues:
Endometrium, Pubmed ID: 17974005
Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 19690332
Lung, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2019-10-01
Question
Does anti-ETS1 antibody A00931-2 work for WB with blood?
Verified Customer
Verified customer
Asked: 2019-08-20
Answer
According to the expression profile of blood, ETS1 is highly expressed in blood. So, it is likely that anti-ETS1 antibody A00931-2 will work for WB with blood.
Boster Scientific Support
Answered: 2019-08-20
Question
I was wanting to use your anti-ETS1 antibody for WB for mouse blood on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse blood identification?
Verified Customer
Verified customer
Asked: 2019-07-15
Answer
You can see on the product datasheet, A00931-2 anti-ETS1 antibody has been validated for WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse blood in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-07-15
Question
We want to test anti-ETS1 antibody A00931-2 on mouse blood for research purposes, then I may be interested in using anti-ETS1 antibody A00931-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-07-02
Answer
The products we sell, including anti-ETS1 antibody A00931-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-07-02
Question
Is there a BSA free version of anti-ETS1 antibody A00931-2 available?
Verified Customer
Verified customer
Asked: 2019-04-23
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-ETS1 antibody A00931-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-04-23
Question
My question regarding product A00931-2, anti-ETS1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2018-04-19
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00931-2 anti-ETS1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-04-19
Question
We are interested in using your anti-ETS1 antibody for positive regulation of cell population proliferation studies. Has this antibody been tested with western blotting on nih3t3 whole cell lysates? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2017-11-30
Answer
We appreciate your inquiry. This A00931-2 anti-ETS1 antibody is validated on nih3t3 whole cell lysates. It is guaranteed to work for WB in human, mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2017-11-30
Question
Would A00931-2 anti-ETS1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2017-09-14
Answer
You can see on the product datasheet, A00931-2 anti-ETS1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-09-14
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for blood using anti-ETS1 antibody A00931-2. Let me know if you need anything else.
C. Parker
Verified customer
Asked: 2016-02-24
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-02-24
Question
Is this A00931-2 anti-ETS1 antibody reactive to the isotypes of ETS1?
K. Yang
Verified customer
Asked: 2015-03-03
Answer
The immunogen of A00931-2 anti-ETS1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human ETS1 (67-98aa KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2015-03-03
Question
We are currently using anti-ETS1 antibody A00931-2 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse. Is it possible that the antibody can work on horse tissues as well?
C. Collins
Verified customer
Asked: 2013-12-31
Answer
The anti-ETS1 antibody (A00931-2) has not been tested for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2013-12-31