Click image to see more details
Product Info Summary
| SKU: | A01376-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-DNA Polymerase iota/POLI Antibody Picoband®
View all DNA Polymerase iota Antibodies
SKU/Catalog Number
A01376-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-DNA Polymerase iota/POLI Antibody Picoband® catalog # A01376-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-DNA Polymerase iota/POLI Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01376-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human DNA Polymerase iota, which shares 70.6% and 76.5% amino acid (aa) sequence identity with mouse and rat DNA Polymerase iota, respectively.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01376-1 is reactive to POLI in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
83 kDa
Calculated molecular weight
83.006kDa
Background of DNA Polymerase iota
DNA polymerase iota is an enzyme that in humans is encoded by the POLI gene. The protein encoded by this gene is an error-prone DNA polymerase involved in DNA repair. The encoded protein promotes DNA synthesis across lesions in the template DNA, which other polymerases cannot do. The encoded polymerase inserts deoxynucleotides across lesions and then relies on DNA polymerase zeta to extend the nascent DNA strand to bypass the lesion.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A01376-1 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Positive Control
WB: human Hela whole cell, human placenta tissue, human A549 whole cell, human SK-OV-3 whole cell, rat testis tissue, rat testis tissue, rat kidney tissue, rat stomach tissue, mouse testis tissue, mouse testis tissue, mouse kidney tissue, mouse stomach tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of DNA Polymerase iota using anti-DNA Polymerase iota antibody (A01376-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human placenta tissue lysates,
Lane 3: human A549 whole cell lysates,
Lane 4: human SK-OV-3 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-DNA Polymerase iota antigen affinity purified polyclonal antibody (Catalog # A01376-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for DNA Polymerase iota at approximately 83KD. The expected band size for DNA Polymerase iota is at 83KD.
Click image to see more details
Figure 2. Western blot analysis of DNA Polymerase iota using anti-DNA Polymerase iota antibody (A01376-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat testis tissue lysates,
Lane 2: rat testis tissue lysates,
Lane 3: rat kidney tissue lysates,
Lane 4: rat stomach tissue lysates,
Lane 5: mouse testis tissue lysates,
Lane 6: mouse testis tissue lysates,
Lane 7: mouse kidney tissue lysates,
Lane 8: mouse stomach tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-DNA Polymerase iota antigen affinity purified polyclonal antibody (Catalog # A01376-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for DNA Polymerase iota at approximately 83KD. The expected band size for DNA Polymerase iota is at 83KD.
Protein Target Info & Infographic
Gene/Protein Information For POLI (Source: Uniprot.org, NCBI)
Gene Name
POLI
Full Name
DNA polymerase iota
Weight
83.006kDa
Superfamily
DNA polymerase type-Y family
Alternative Names
DNA polymerase iota; Eta2; RAD30 homolog B; POLI; RAD30B POLI RAD30B, RAD3OB, eta2 DNA polymerase iota DNA polymerase iota|RAD30 homolog B|polymerase (DNA directed) iota|polymerase (DNA) iota|polymerase (DNA-directed), iota
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on POLI, check out the POLI Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for POLI: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-DNA Polymerase iota/POLI Antibody Picoband® (A01376-1)
Hello CJ!
No publications found for A01376-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-DNA Polymerase iota/POLI Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-DNA Polymerase iota/POLI Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-DNA Polymerase iota/POLI Antibody Picoband®
Question
Is this A01376-1 anti-DNA Polymerase iota/POLI antibody reactive to the isotypes of POLI?
Verified Customer
Verified customer
Asked: 2019-10-08
Answer
The immunogen of A01376-1 anti-DNA Polymerase iota/POLI antibody is A synthetic peptide corresponding to a sequence of human DNA Polymerase iota (DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-10-08
Question
Does anti-DNA Polymerase iota/POLI antibody A01376-1 work for WB with kidney?
Verified Customer
Verified customer
Asked: 2019-10-03
Answer
According to the expression profile of kidney, POLI is highly expressed in kidney. So, it is likely that anti-DNA Polymerase iota/POLI antibody A01376-1 will work for WB with kidney.
Boster Scientific Support
Answered: 2019-10-03
Question
See attached the WB image, lot number and protocol we used for kidney using anti-DNA Polymerase iota/POLI antibody A01376-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-09-25
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-09-25
Question
We are currently using anti-DNA Polymerase iota/POLI antibody A01376-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on feline tissues as well?
S. Anderson
Verified customer
Asked: 2019-04-22
Answer
The anti-DNA Polymerase iota/POLI antibody (A01376-1) has not been validated for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-04-22
Question
Is a blocking peptide available for product anti-DNA Polymerase iota/POLI antibody (A01376-1)?
Verified Customer
Verified customer
Asked: 2018-07-02
Answer
We do provide the blocking peptide for product anti-DNA Polymerase iota/POLI antibody (A01376-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-07-02
Question
Would anti-DNA Polymerase iota/POLI antibody A01376-1 work on horse WB with uterus?
Verified Customer
Verified customer
Asked: 2017-08-15
Answer
Our lab technicians have not tested anti-DNA Polymerase iota/POLI antibody A01376-1 on horse. You can run a BLAST between horse and the immunogen sequence of anti-DNA Polymerase iota/POLI antibody A01376-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse uterus in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-08-15
Question
Would A01376-1 anti-DNA Polymerase iota/POLI antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
N. Parker
Verified customer
Asked: 2013-06-12
Answer
As indicated on the product datasheet, A01376-1 anti-DNA Polymerase iota/POLI antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2013-06-12
