Anti-DNA Polymerase iota/POLI Antibody Picoband™

DNA Polymerase iota antibody

Boster Bio Anti-DNA Polymerase iota/POLI Antibody Picoband™ catalog # A01376-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A01376-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-DNA Polymerase iota/POLI Antibody Picoband™

View all DNA Polymerase iota Antibodies

SKU/Catalog Number

A01376-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-DNA Polymerase iota/POLI Antibody Picoband™ catalog # A01376-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-DNA Polymerase iota/POLI Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01376-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human DNA Polymerase iota, which shares 70.6% and 76.5% amino acid (aa) sequence identity with mouse and rat DNA Polymerase iota, respectively.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A01376-1 is reactive to POLI in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

83 kDa

Calculated molecular weight

Background of DNA Polymerase iota

DNA polymerase iota is an enzyme that in humans is encoded by the POLI gene. The protein encoded by this gene is an error-prone DNA polymerase involved in DNA repair. The encoded protein promotes DNA synthesis across lesions in the template DNA, which other polymerases cannot do. The encoded polymerase inserts deoxynucleotides across lesions and then relies on DNA polymerase zeta to extend the nascent DNA strand to bypass the lesion.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A01376-1 is guaranteed for WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml

Positive Control

Validation Images & Assay Conditions

Gene/Protein Information For POLI (Source: Uniprot.org, NCBI)

Gene Name

POLI

Full Name

DNA polymerase iota

Weight

Superfamily

DNA polymerase type-Y family

Alternative Names

DNA polymerase iota; EC 2.7.7.7; eta2; polymerase (DNA directed) iota; RAD30 homolog B; RAD30Bpolymerase (DNA-directed), iota; RAD3OB POLI RAD30B, RAD3OB, eta2 DNA polymerase iota DNA polymerase iota|RAD30 homolog B|polymerase (DNA directed) iota|polymerase (DNA) iota|polymerase (DNA-directed), iota

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on POLI, check out the POLI Infographic

POLI infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POLI: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A01376-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-DNA Polymerase iota/POLI Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-DNA Polymerase iota/POLI Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-DNA Polymerase iota/POLI Antibody Picoband™

Question

Is this A01376-1 anti-DNA Polymerase iota/POLI antibody reactive to the isotypes of POLI?

Verified Customer

Verified customer

Asked: 2019-10-08

Answer

The immunogen of A01376-1 anti-DNA Polymerase iota/POLI antibody is A synthetic peptide corresponding to a sequence of human DNA Polymerase iota (DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-10-08

Question

Does anti-DNA Polymerase iota/POLI antibody A01376-1 work for WB with kidney?

Verified Customer

Verified customer

Asked: 2019-10-03

Answer

According to the expression profile of kidney, POLI is highly expressed in kidney. So, it is likely that anti-DNA Polymerase iota/POLI antibody A01376-1 will work for WB with kidney.

Boster Scientific Support

Answered: 2019-10-03

Question

See attached the WB image, lot number and protocol we used for kidney using anti-DNA Polymerase iota/POLI antibody A01376-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-09-25

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-09-25

Question

We are currently using anti-DNA Polymerase iota/POLI antibody A01376-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on feline tissues as well?

S. Anderson

Verified customer

Asked: 2019-04-22

Answer

The anti-DNA Polymerase iota/POLI antibody (A01376-1) has not been validated for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-04-22

Question

Is a blocking peptide available for product anti-DNA Polymerase iota/POLI antibody (A01376-1)?

Verified Customer

Verified customer

Asked: 2018-07-02

Answer

We do provide the blocking peptide for product anti-DNA Polymerase iota/POLI antibody (A01376-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-07-02

Question

Would anti-DNA Polymerase iota/POLI antibody A01376-1 work on horse WB with uterus?

Verified Customer

Verified customer

Asked: 2017-08-15

Answer

Our lab technicians have not tested anti-DNA Polymerase iota/POLI antibody A01376-1 on horse. You can run a BLAST between horse and the immunogen sequence of anti-DNA Polymerase iota/POLI antibody A01376-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse uterus in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-08-15

Question

Would A01376-1 anti-DNA Polymerase iota/POLI antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

N. Parker

Verified customer

Asked: 2013-06-12

Answer

As indicated on the product datasheet, A01376-1 anti-DNA Polymerase iota/POLI antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2013-06-12

Order DetailsPrice
A01376-1

100μg

$370
A01376-1-10ug

10μg sample (liquid)

$99
A01376-1-Biotin

100 μg Biotin conjugated

$570
A01376-1-Cy3

100 μg Cy3 conjugated

$570
A01376-1-Dylight488

100 μg Dylight488 conjugated

$570
A01376-1-Dylight550

100 μg Dylight550 conjugated

$570
A01376-1-Dylight594

100 μg Dylight594 conjugated

$570
A01376-1-FITC

100 μg FITC conjugated

$570
A01376-1-HRP

100 μg HRP conjugated

$570
A01376-1-APC

100 μg APC conjugated

$670
A01376-1-PE

100 μg PE conjugated

$670
A01376-1-iFluor647

100 μg iFluor647 conjugated

$670
A01376-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01376-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.