Click image to see more details
Product Info Summary
| SKU: | A03577 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Dishevelled 3/DVL3 Antibody Picoband®
View all Dishevelled-3 Antibodies
SKU/Catalog Number
A03577
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Dishevelled 3/DVL3 Antibody Picoband® catalog # A03577. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Dishevelled 3/DVL3 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03577)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3, identical to the related mouse sequence.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A03577 is reactive to DVL3 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
78 kDa
Calculated molecular weight
78055 MW
Background of Dishevelled-3
Segment polarity protein dishevelled homolog DVL-3 is a protein that in humans is encoded by the DVL3 gene. It is mapped to 3q27.1. This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A03577 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human
Positive Control
WB: rat brain tissue, mouse brain tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Dishevelled 3 using anti-Dishevelled 3 antibody (A03577).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysates,
Lane 2: mouse brain tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Dishevelled 3 antigen affinity purified polyclonal antibody (Catalog # A03577) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Dishevelled 3 at approximately 78KD. The expected band size for Dishevelled 3 is at 78KD.
Protein Target Info & Infographic
Gene/Protein Information For DVL3 (Source: Uniprot.org, NCBI)
Gene Name
DVL3
Full Name
Segment polarity protein dishevelled homolog DVL-3
Weight
78055 MW
Superfamily
DSH family
Alternative Names
Segment polarity protein dishevelled homolog DVL-3;Dishevelled-3;DSH homolog 3;DVL3;KIAA0208; DVL3 DRS3 dishevelled segment polarity protein 3 segment polarity protein dishevelled homolog DVL-3|dishevelled 3 (homologous to Drosophila dsh)|dishevelled, dsh homolog 3
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on DVL3, check out the DVL3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for DVL3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Dishevelled 3/DVL3 Antibody Picoband® (A03577)
Hello CJ!
No publications found for A03577
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Dishevelled 3/DVL3 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Dishevelled 3/DVL3 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-Dishevelled 3/DVL3 Antibody Picoband®
Question
Is this A03577 anti-Dishevelled 3/DVL3 antibody reactive to the isotypes of DVL3?
Verified Customer
Verified customer
Asked: 2020-01-22
Answer
The immunogen of A03577 anti-Dishevelled 3/DVL3 antibody is A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-01-22
Question
My question regarding product A03577, anti-Dishevelled 3/DVL3 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-10-10
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A03577 anti-Dishevelled 3/DVL3 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-10-10
Question
I have attached the WB image, lot number and protocol we used for brain using anti-Dishevelled 3/DVL3 antibody A03577. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-06-28
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-06-28
Question
We are currently using anti-Dishevelled 3/DVL3 antibody A03577 for rat tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on primate tissues as well?
Verified Customer
Verified customer
Asked: 2019-05-22
Answer
The anti-Dishevelled 3/DVL3 antibody (A03577) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-05-22
Question
I was wanting to use to test anti-Dishevelled 3/DVL3 antibody A03577 on mouse brain for research purposes, then I may be interested in using anti-Dishevelled 3/DVL3 antibody A03577 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-09-20
Answer
The products we sell, including anti-Dishevelled 3/DVL3 antibody A03577, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-09-20
Question
Does anti-Dishevelled 3/DVL3 antibody A03577 work for WB with brain?
R. Parker
Verified customer
Asked: 2013-07-05
Answer
According to the expression profile of brain, DVL3 is highly expressed in brain. So, it is likely that anti-Dishevelled 3/DVL3 antibody A03577 will work for WB with brain.
Boster Scientific Support
Answered: 2013-07-05
