Product Info Summary
SKU: | A01499-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-CRB1 Antibody Picoband®
SKU/Catalog Number
A01499-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-CRB1 Antibody Picoband® catalog # A01499-1. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-CRB1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01499-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CRB1, which shares 87.9% and 84.8% amino acid (aa) sequence identity with mouse and rat CRB1, respectively.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01499-1 is reactive to CRB1 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
154 kDa
Calculated molecular weight
75679 MW
Background of CRB1
Crumbs homolog 1 is a protein that in humans is encoded by the CRB1 gene. This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A01499-1 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human
Positive Control
WB: human HEK293 whole cell, human U-87MG whole cell
IHC: mouse testis tissue, human testis cancer tissue, rat testis tissue, human glioma tissue
FCM: U87 cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. IHC analysis of CRB1 using anti-CRB1 antibody (A01499-1).
CRB1 was detected in paraffin-embedded section of mouse testis tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CRB1 Antibody (A01499-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 2. IHC analysis of CRB1 using anti-CRB1 antibody (A01499-1).
CRB1 was detected in paraffin-embedded section of human testis cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CRB1 Antibody (A01499-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of CRB1 using anti-CRB1 antibody (A01499-1).
CRB1 was detected in paraffin-embedded section of rat testis tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CRB1 Antibody (A01499-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of CRB1 using anti-CRB1 antibody (A01499-1).
CRB1 was detected in paraffin-embedded section of human glioma tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CRB1 Antibody (A01499-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. Flow Cytometry analysis of U87 cells using anti-CRB1 antibody (A01499-1).
Overlay histogram showing U87 cells stained with A01499-1 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CRB1 Antibody (A01499-1,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Click image to see more details
Figure 6. Western blot analysis of CRB1 using anti-CRB1 antibody (A01499-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human HEK293 whole cell lysates,
Lane 2: human U-87MG whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CRB1 antigen affinity purified polyclonal antibody (Catalog # A01499-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for CRB1 at approximately 154KD. The expected band size for CRB1 is at 154KD.
Protein Target Info & Infographic
Gene/Protein Information For CRB1 (Source: Uniprot.org, NCBI)
Gene Name
CRB1
Full Name
Protein crumbs homolog 1
Weight
75679 MW
Superfamily
Crumbs protein family
Alternative Names
Protein crumbs homolog 1; CRB1 CRB1 CRB1-A-B, CRB1-C, LCA8, RP12, CRB1 crumbs cell polarity complex component 1 protein crumbs homolog 1|crumbs 1, cell polarity complex component|crumbs family member 1, photoreceptor morphogenesis associated
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on CRB1, check out the CRB1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CRB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-CRB1 Antibody Picoband® (A01499-1)
Hello CJ!
A01499-1 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Son S,Cho M,Lee J.Crumbs proteins regulate layered retinal vascular development required for vision.Biochem Biophys Res Commun.2020 Jan 22;521(4):939-946.doi:10.1016/j.bbrc.2019.11.013.Epub 2019 Nov 11.PMID:31718797.
Species: Human,Mouse
A01499-1 usage in article: APP:WB, SAMPLE:RETINAL TISSUE, DILUTION:NA
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-CRB1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-CRB1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-CRB1 Antibody Picoband®
Question
is this antibody c-terminal or n-terminal? Can you mention which CRB1 exonic region code for this peptide?
Verified customer
Asked: 2022-10-30
Answer
The immunogen sequence for A01499-1 is listed below. FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ https://www.uniprot.org/uniprotkb/P82279/entry#sequences
Boster Scientific Support
Answered: 2022-10-31
Question
Is there a BSA free version of anti-CRB1 antibody A01499-1 available?
Verified Customer
Verified customer
Asked: 2019-12-20
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-CRB1 antibody A01499-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-12-20
Question
Does A01499-1 anti-CRB1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-04-16
Answer
You can see on the product datasheet, A01499-1 anti-CRB1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-04-16
Question
I was wanting to use your anti-CRB1 antibody for WB for rat cerebellum on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat cerebellum identification?
Verified Customer
Verified customer
Asked: 2019-04-04
Answer
You can see on the product datasheet, A01499-1 anti-CRB1 antibody has been validated for Flow Cytometry, IHC-P, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat cerebellum in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-04-04
Question
We are currently using anti-CRB1 antibody A01499-1 for rat tissue, and we are well pleased with the Flow Cytometry results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on primate tissues as well?
Verified Customer
Verified customer
Asked: 2019-03-28
Answer
The anti-CRB1 antibody (A01499-1) has not been validated for cross reactivity specifically with primate tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-03-28