Anti-CRB1 Antibody Picoband®

CRB1 antibody

Boster Bio Anti-CRB1 Antibody Picoband® catalog # A01499-1. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 1 publication(s).

Product Info Summary

SKU: A01499-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-CRB1 Antibody Picoband®

View all CRB1 Antibodies

SKU/Catalog Number

A01499-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-CRB1 Antibody Picoband® catalog # A01499-1. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CRB1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01499-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human CRB1, which shares 87.9% and 84.8% amino acid (aa) sequence identity with mouse and rat CRB1, respectively.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A01499-1 is reactive to CRB1 in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

154 kDa

Calculated molecular weight

75679 MW

Background of CRB1

Crumbs homolog 1 is a protein that in humans is encoded by the CRB1 gene. This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A01499-1 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: human HEK293 whole cell, human U-87MG whole cell
IHC: mouse testis tissue, human testis cancer tissue, rat testis tissue, human glioma tissue
FCM: U87 cell

Validation Images & Assay Conditions

Gene/Protein Information For CRB1 (Source: Uniprot.org, NCBI)

Gene Name

CRB1

Full Name

Protein crumbs homolog 1

Weight

75679 MW

Superfamily

Crumbs protein family

Alternative Names

Protein crumbs homolog 1; CRB1 CRB1 CRB1-A-B, CRB1-C, LCA8, RP12, CRB1 crumbs cell polarity complex component 1 protein crumbs homolog 1|crumbs 1, cell polarity complex component|crumbs family member 1, photoreceptor morphogenesis associated

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on CRB1, check out the CRB1 Infographic

CRB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CRB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A01499-1 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Son S,Cho M,Lee J.Crumbs proteins regulate layered retinal vascular development required for vision.Biochem Biophys Res Commun.2020 Jan 22;521(4):939-946.doi:10.1016/j.bbrc.2019.11.013.Epub 2019 Nov 11.PMID:31718797.
Species: Human,Mouse
A01499-1 usage in article: APP:WB, SAMPLE:RETINAL TISSUE, DILUTION:NA

Have you used Anti-CRB1 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-CRB1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-CRB1 Antibody Picoband®

Question

is this antibody c-terminal or n-terminal? Can you mention which CRB1 exonic region code for this peptide?

Verified customer

Asked: 2022-10-30

Answer

The immunogen sequence for A01499-1 is listed below. FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ https://www.uniprot.org/uniprotkb/P82279/entry#sequences

Boster Scientific Support

Answered: 2022-10-31

Question

Is there a BSA free version of anti-CRB1 antibody A01499-1 available?

Verified Customer

Verified customer

Asked: 2019-12-20

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-CRB1 antibody A01499-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-12-20

Question

Does A01499-1 anti-CRB1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-04-16

Answer

You can see on the product datasheet, A01499-1 anti-CRB1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-04-16

Question

I was wanting to use your anti-CRB1 antibody for WB for rat cerebellum on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat cerebellum identification?

Verified Customer

Verified customer

Asked: 2019-04-04

Answer

You can see on the product datasheet, A01499-1 anti-CRB1 antibody has been validated for Flow Cytometry, IHC-P, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat cerebellum in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-04-04

Question

We are currently using anti-CRB1 antibody A01499-1 for rat tissue, and we are well pleased with the Flow Cytometry results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2019-03-28

Answer

The anti-CRB1 antibody (A01499-1) has not been validated for cross reactivity specifically with primate tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-03-28

Order DetailsPrice
A01499-1

100μg

$370
A01499-1-10ug

10μg sample (liquid)

$99
A01499-1-Biotin

100 μg Biotin conjugated

$570
A01499-1-Cy3

100 μg Cy3 conjugated

$570
A01499-1-Dylight488

100 μg Dylight488 conjugated

$570
A01499-1-Dylight550

100 μg Dylight550 conjugated

$570
A01499-1-Dylight594

100 μg Dylight594 conjugated

$570
A01499-1-FITC

100 μg FITC conjugated

$570
A01499-1-HRP

100 μg HRP conjugated

$570
A01499-1-APC

100 μg APC conjugated

$670
A01499-1-PE

100 μg PE conjugated

$670
A01499-1-iFluor647

100 μg iFluor647 conjugated

$670
A01499-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01499-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.