Click image to see more details
Product Info Summary
| SKU: | A00480-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | Flow Cytometry, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-CD5 Antibody Picoband®
SKU/Catalog Number
A00480-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-CD5 Antibody Picoband® catalog # A00480-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-CD5 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00480-1)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CD5, which shares 92.1% and 89.5% amino acid (aa) sequence identity with mouse and rat CD5, respectively.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00480-1 is reactive to CD5 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
67 kDa
Calculated molecular weight
18866 MW
Background of CD5
CD5 is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. In humans, the gene is located on the long arm of chromosome 11. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00480-1 is guaranteed for Flow Cytometry, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Positive Control
WB: human Jurkat whole cell, human CCRF-CEM whole cell, human MOLT-4 whole cell, rat thymus tissue, mouse thymus tissue
FCM: Jurkat cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of CD5 using anti-CD5 antibody (A00480-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Jurkat whole cell lysates,
Lane 2: human CCRF-CEM whole cell lysates,
Lane 3: human MOLT-4 whole cell lysates,
Lane 4: rat thymus tissue lysates,
Lane 5: mouse thymus tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CD5 antigen affinity purified polyclonal antibody (Catalog # A00480-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for CD5 at approximately 67 kDa. The expected band size for CD5 is at 54 kDa.
Click image to see more details
Figure 2. Flow Cytometry analysis of Jurkat cells using anti-CD54 antibody (A00480-1).
Overlay histogram showing Jurkat cells stained with A00480-1 (Blue line). The cells were fixed with 4% paraformaldehyde and blocked with 10% normal goat serum. And then incubated with rabbit anti-CD5 Antibody (A00480-1, 1 μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10 μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1 μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For CD5 (Source: Uniprot.org, NCBI)
Gene Name
CD5
Full Name
T-cell surface glycoprotein CD5
Weight
18866 MW
Alternative Names
T-cell surface glycoprotein CD5; Lymphocyte antigen T1/Leu-1; CD5; CD5; LEU1 CD5 LEU1, T1 CD5 molecule T-cell surface glycoprotein CD5|CD5 (p56-62)|epididymis secretory sperm binding protein|lymphocyte T1/Leu-1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on CD5, check out the CD5 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CD5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-CD5 Antibody Picoband® (A00480-1)
Hello CJ!
No publications found for A00480-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-CD5 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-CD5 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-CD5 Antibody Picoband®
Question
I was wanting to use your anti-CD5 antibody for IHC for mouse thymus on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse thymus identification?
Verified Customer
Verified customer
Asked: 2020-03-19
Answer
You can see on the product datasheet, A00480-1 anti-CD5 antibody has been validated for Flow Cytometry, IHC, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse thymus in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-03-19
Question
My boss were satisfied with the WB result of your anti-CD5 antibody. However we have been able to see positive staining in thymus cell membrane using this antibody. Is that expected? Could you tell me where is CD5 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-02-12
Answer
Based on literature, thymus does express CD5. Generally CD5 expresses in cell membrane. Regarding which tissues have CD5 expression, here are a few articles citing expression in various tissues:
Leukemic T-cell, Pubmed ID: 15144186, 19690332
Lymphocyte, Pubmed ID: 8740779
Pancreas, Pubmed ID: 15489334
Thymus, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2020-02-12
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for thymus using anti-CD5 antibody A00480-1. Let me know if you need anything else.
M. Edwards
Verified customer
Asked: 2020-01-06
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-06
Question
Is this A00480-1 anti-CD5 antibody reactive to the isotypes of CD5?
Verified Customer
Verified customer
Asked: 2019-12-11
Answer
The immunogen of A00480-1 anti-CD5 antibody is A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-12-11
Question
We have been able to see staining in mouse leukemic t-cell. Any tips? Is anti-CD5 antibody supposed to stain leukemic t-cell positively?
Verified Customer
Verified customer
Asked: 2019-07-29
Answer
From what I have seen in literature leukemic t-cell does express CD5. From what I have seen in Uniprot.org, CD5 is expressed in leukocyte, lymphocyte, thymus, pancreas, leukemic t-cell, among other tissues. Regarding which tissues have CD5 expression, here are a few articles citing expression in various tissues:
Leukemic T-cell, Pubmed ID: 15144186, 19690332
Lymphocyte, Pubmed ID: 8740779
Pancreas, Pubmed ID: 15489334
Thymus, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-07-29
Question
I see that the anti-CD5 antibody A00480-1 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-07-22
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-07-22
Question
Will anti-CD5 antibody A00480-1 work for IHC with thymus?
M. Gonzalez
Verified customer
Asked: 2019-04-26
Answer
According to the expression profile of thymus, CD5 is highly expressed in thymus. So, it is likely that anti-CD5 antibody A00480-1 will work for IHC with thymus.
Boster Scientific Support
Answered: 2019-04-26
Question
Is a blocking peptide available for product anti-CD5 antibody (A00480-1)?
C. Mangal
Verified customer
Asked: 2019-01-16
Answer
We do provide the blocking peptide for product anti-CD5 antibody (A00480-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-01-16
Question
I am interested in using your anti-CD5 antibody for cell population proliferation studies. Has this antibody been tested with western blotting on human hela? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2018-11-21
Answer
I appreciate your inquiry. This A00480-1 anti-CD5 antibody is tested on rat liver tissue, human hela, pbmc cells. It is guaranteed to work for Flow Cytometry, IHC, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2018-11-21
Question
See attached the WB image, lot number and protocol we used for thymus using anti-CD5 antibody A00480-1. Please let me know if you require anything else.
P. Anderson
Verified customer
Asked: 2018-06-04
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-06-04
Question
you antibody to test anti-CD5 antibody A00480-1 on mouse thymus for research purposes, then I may be interested in using anti-CD5 antibody A00480-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
J. Taylor
Verified customer
Asked: 2017-12-15
Answer
The products we sell, including anti-CD5 antibody A00480-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2017-12-15
Question
Our lab used your anti-CD5 antibody for WB on leukocyte a few months ago. I am using rat, and We want to use the antibody for ICC next. I am interested in examining leukocyte as well as leukemic t-cell in our next experiment. Could you please give me some suggestion on which antibody would work the best for ICC?
Verified Customer
Verified customer
Asked: 2017-11-28
Answer
I have checked the website and datasheets of our anti-CD5 antibody and it seems that A00480-1 has been tested on rat in both WB and ICC. Thus A00480-1 should work for your application. Our Boster satisfaction guarantee will cover this product for ICC in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for ICC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2017-11-28
Question
Does A00480-1 anti-CD5 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2017-07-26
Answer
You can see on the product datasheet, A00480-1 anti-CD5 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-07-26
Question
We are currently using anti-CD5 antibody A00480-1 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on goat tissues as well?
G. Rodriguez
Verified customer
Asked: 2017-01-18
Answer
The anti-CD5 antibody (A00480-1) has not been tested for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-01-18
Question
Do you have a BSA free version of anti-CD5 antibody A00480-1 available?
J. Johnson
Verified customer
Asked: 2016-07-18
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-CD5 antibody A00480-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2016-07-18
Question
I have a question about product A00480-1, anti-CD5 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
A. Carter
Verified customer
Asked: 2016-04-13
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00480-1 anti-CD5 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2016-04-13
