Anti-CD229/LY9 Antibody Picoband™

CD229/SLAMF3/Lymphocyte Antigen 9 antibody

Boster Bio Anti-CD229/LY9 Antibody Picoband™ catalog # A05830-1. Tested in Flow Cytometry, IHC, ICC applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A05830-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, ICC

Product Name

Anti-CD229/LY9 Antibody Picoband™

View all CD229/SLAMF3/Lymphocyte Antigen 9 Antibodies

SKU/Catalog Number

A05830-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-CD229/LY9 Antibody Picoband™ catalog # A05830-1. Tested in Flow Cytometry, IHC, ICC applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CD229/LY9 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A05830-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human CD229/LY9, which shares 55.9% and 61.8% amino acid (aa) sequence identity with mouse and rat CD229/LY9, respectively.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A05830-1 is reactive to LY9 in Human, Mouse, Rat

Applications

A05830-1 is guaranteed for Flow Cytometry, IHC, ICC Boster Guarantee

Observed Molecular Weight

28 kDa

Calculated molecular weight

Background of CD229/SLAMF3/Lymphocyte Antigen 9

T-lymphocyte surface antigen Ly-9 is a protein that in humans is encoded by the LY9 gene. This gene is mapped to 17q21.31. LY9 has also recently been designated CD229 (cluster of differentiation 229). LY9 belongs to the SLAM family of immunomodulatory receptors and interacts with the adaptor molecule SAP.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry, 0.5-1μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For LY9 (Source: Uniprot.org, NCBI)

Gene Name

LY9

Full Name

T-lymphocyte surface antigen Ly-9

Weight

Alternative Names

CD229 antigen; CD229; cell-surface molecule Ly-9; hly9; Ly9; lymphocyte antigen 9Cell surface molecule Ly-9; mLY9; SLAMF3; T-lymphocyte surface antigen Ly-9 LY9 CD229, SLAMF3, hly9, mLY9 lymphocyte antigen 9 T-lymphocyte surface antigen Ly-9|SLAM family member 3|cell surface molecule Ly-9|signaling lymphocytic activation molecule 3

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on LY9, check out the LY9 Infographic

LY9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LY9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A05830-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-CD229/LY9 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-CD229/LY9 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-CD229/LY9 Antibody Picoband™

Question

Will anti-CD229/LY9 antibody A05830-1 work on dog Flow Cytometry with leukemic t-cell?

Verified Customer

Verified customer

Asked: 2020-01-01

Answer

Our lab technicians have not validated anti-CD229/LY9 antibody A05830-1 on dog. You can run a BLAST between dog and the immunogen sequence of anti-CD229/LY9 antibody A05830-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated dog samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in dog leukemic t-cell in Flow Cytometry, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-01-01

Question

Is this A05830-1 anti-CD229/LY9 antibody reactive to the isotypes of LY9?

B. Evans

Verified customer

Asked: 2019-08-27

Answer

The immunogen of A05830-1 anti-CD229/LY9 antibody is A synthetic peptide corresponding to a sequence of human CD229/LY9 (YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-08-27

Question

We are currently using anti-CD229/LY9 antibody A05830-1 for rat tissue, and we are happy with the ICC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-14

Answer

The anti-CD229/LY9 antibody (A05830-1) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-14

Question

you antibody to test anti-CD229/LY9 antibody A05830-1 on mouse leukemia for research purposes, then I may be interested in using anti-CD229/LY9 antibody A05830-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-06-21

Answer

The products we sell, including anti-CD229/LY9 antibody A05830-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-06-21

Order DetailsPrice
A05830-1

100μg

$370
A05830-1-10ug

10μg sample (liquid)

$99
A05830-1-Biotin

100 μg Biotin conjugated

$570
A05830-1-Cy3

100 μg Cy3 conjugated

$570
A05830-1-Dylight488

100 μg Dylight488 conjugated

$570
A05830-1-Dylight550

100 μg Dylight550 conjugated

$570
A05830-1-Dylight594

100 μg Dylight594 conjugated

$570
A05830-1-FITC

100 μg FITC conjugated

$570
A05830-1-HRP

100 μg HRP conjugated

$570
A05830-1-APC

100 μg APC conjugated

$670
A05830-1-PE

100 μg PE conjugated

$670
A05830-1-iFluor647

100 μg iFluor647 conjugated

$670
A05830-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A05830-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.