Product Info Summary
SKU: | A05830-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IHC, ICC |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-CD229/LY9 Antibody Picoband™
View all CD229/SLAMF3/Lymphocyte Antigen 9 Antibodies
SKU/Catalog Number
A05830-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-CD229/LY9 Antibody Picoband™ catalog # A05830-1. Tested in Flow Cytometry, IHC, ICC applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-CD229/LY9 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A05830-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CD229/LY9, which shares 55.9% and 61.8% amino acid (aa) sequence identity with mouse and rat CD229/LY9, respectively.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A05830-1 is reactive to LY9 in Human, Mouse, Rat
Applications
A05830-1 is guaranteed for Flow Cytometry, IHC, ICC Boster Guarantee
Observed Molecular Weight
28 kDa
Calculated molecular weight
Background of CD229/SLAMF3/Lymphocyte Antigen 9
T-lymphocyte surface antigen Ly-9 is a protein that in humans is encoded by the LY9 gene. This gene is mapped to 17q21.31. LY9 has also recently been designated CD229 (cluster of differentiation 229). LY9 belongs to the SLAM family of immunomodulatory receptors and interacts with the adaptor molecule SAP.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry, 0.5-1μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Validation Images & Assay Conditions
![a05830 1 cd229 primary antibodies ihc testing 1 a05830 1 cd229 primary antibodies ihc testing 1](https://www.bosterbio.com/media/catalog/product/a/0/a05830-1-cd229-primary-antibodies-ihc-testing-1.jpg)
Click image to see more details
Figure 1. IHC analysis of CD229 using anti-CD229 antibody (A05830-1).
CD229 was detected in paraffin-embedded section of mouse spleen tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CD229 Antibody (A05830-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
![a05830 1 cd229 primary antibodies ihc testing 2 a05830 1 cd229 primary antibodies ihc testing 2](https://www.bosterbio.com/media/catalog/product/a/0/a05830-1-cd229-primary-antibodies-ihc-testing-2.jpg)
Click image to see more details
Figure 2. IHC analysis of CD229 using anti-CD229 antibody (A05830-1).
CD229 was detected in paraffin-embedded section of mouse spleen tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CD229 Antibody (A05830-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
![a05830 1 cd229 primary antibodies ihc testing 3 a05830 1 cd229 primary antibodies ihc testing 3](https://www.bosterbio.com/media/catalog/product/a/0/a05830-1-cd229-primary-antibodies-ihc-testing-3.jpg)
Click image to see more details
Figure 3. IHC analysis of CD229 using anti-CD229 antibody (A05830-1).
CD229 was detected in paraffin-embedded section of rat spleen tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CD229 Antibody (A05830-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
![a05830 1 cd229 primary antibodies ihc testing 4 a05830 1 cd229 primary antibodies ihc testing 4](https://www.bosterbio.com/media/catalog/product/a/0/a05830-1-cd229-primary-antibodies-ihc-testing-4.jpg)
Click image to see more details
Figure 4. IHC analysis of CD229 using anti-CD229 antibody (A05830-1).
CD229 was detected in paraffin-embedded section of rat spleen tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CD229 Antibody (A05830-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
![a05830 1 cd229 primary antibodies fcm testing 5 a05830 1 cd229 primary antibodies fcm testing 5](https://www.bosterbio.com/media/catalog/product/a/0/a05830-1-cd229-primary-antibodies-fcm-testing-5.png)
Click image to see more details
Figure 5. Flow Cytometry analysis of Jurkat cells using anti-CD229 antibody (A05830-1).
Overlay histogram showing Jurkat cells stained with A05830-1 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CD229 Antibody (A05830-1,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
![a05830 1 cd229 primary antibodies fcm testing 6 a05830 1 cd229 primary antibodies fcm testing 6](https://www.bosterbio.com/media/catalog/product/a/0/a05830-1-cd229-primary-antibodies-fcm-testing-6.png)
Click image to see more details
Figure 6. Flow Cytometry analysis of Daudi cells using anti-CD229 antibody (A05830-1).
Overlay histogram showing Daudi cells stained with A05830-1 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CD229 Antibody (A05830-1,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
![a05830 1 cd229 primary antibodies fcm testing 7 a05830 1 cd229 primary antibodies fcm testing 7](https://www.bosterbio.com/media/catalog/product/a/0/a05830-1-cd229-primary-antibodies-fcm-testing-7.png)
Click image to see more details
Figure 7. Flow Cytometry analysis of U937 cells using anti-CD229 antibody (A05830-1).
Overlay histogram showing U937 cells stained with A05830-1 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CD229 Antibody (A05830-1,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For LY9 (Source: Uniprot.org, NCBI)
Gene Name
LY9
Full Name
T-lymphocyte surface antigen Ly-9
Weight
Alternative Names
CD229 antigen; CD229; cell-surface molecule Ly-9; hly9; Ly9; lymphocyte antigen 9Cell surface molecule Ly-9; mLY9; SLAMF3; T-lymphocyte surface antigen Ly-9 LY9 CD229, SLAMF3, hly9, mLY9 lymphocyte antigen 9 T-lymphocyte surface antigen Ly-9|SLAM family member 3|cell surface molecule Ly-9|signaling lymphocytic activation molecule 3
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on LY9, check out the LY9 Infographic
![LY9 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for LY9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-CD229/LY9 Antibody Picoband™ (A05830-1)
Hello CJ!
No publications found for A05830-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-CD229/LY9 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-CD229/LY9 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-CD229/LY9 Antibody Picoband™
Question
Will anti-CD229/LY9 antibody A05830-1 work on dog Flow Cytometry with leukemic t-cell?
Verified Customer
Verified customer
Asked: 2020-01-01
Answer
Our lab technicians have not validated anti-CD229/LY9 antibody A05830-1 on dog. You can run a BLAST between dog and the immunogen sequence of anti-CD229/LY9 antibody A05830-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated dog samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in dog leukemic t-cell in Flow Cytometry, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-01-01
Question
Is this A05830-1 anti-CD229/LY9 antibody reactive to the isotypes of LY9?
B. Evans
Verified customer
Asked: 2019-08-27
Answer
The immunogen of A05830-1 anti-CD229/LY9 antibody is A synthetic peptide corresponding to a sequence of human CD229/LY9 (YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-08-27
Question
We are currently using anti-CD229/LY9 antibody A05830-1 for rat tissue, and we are happy with the ICC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on bovine tissues as well?
Verified Customer
Verified customer
Asked: 2019-08-14
Answer
The anti-CD229/LY9 antibody (A05830-1) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-08-14
Question
you antibody to test anti-CD229/LY9 antibody A05830-1 on mouse leukemia for research purposes, then I may be interested in using anti-CD229/LY9 antibody A05830-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-06-21
Answer
The products we sell, including anti-CD229/LY9 antibody A05830-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-06-21