Anti-C/EBP epsilon CEBPE Antibody

CEBP epsilon antibody

Boster Bio Anti-C/EBP epsilon CEBPE Antibody catalog # A03884-1. Tested in WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A03884-1
Size: 100μl
Reactive Species: Human
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-C/EBP epsilon CEBPE Antibody

View all CEBP epsilon Antibodies

SKU/Catalog Number

A03884-1

Size

100μl

Form

Liquid

Description

Boster Bio Anti-C/EBP epsilon CEBPE Antibody catalog # A03884-1. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-C/EBP epsilon CEBPE Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03884-1)

Host

Rabbit

Contents

Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.

Clonality

Polyclonal

Isotype

IgG

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRDM9 Synthetic peptide CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Reactive Species

A03884-1 is reactive to CEBPE in Human

Applications

A03884-1 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

39 kDa

Calculated molecular weight

30603 MW

Background of CEBP epsilon

Transcriptional repressor which binds neuron-restrictive silencer element (NRSE) and represses neuronal gene transcription in non-neuronal cells. Restricts the expression of neuronal genes by associating with two distinct corepressors, mSin3 and CoREST, which in turn recruit histone deacetylase to the promoters of REST-regulated genes. Mediates repression by recruiting the BHC complex at RE1/NRSE sites which acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier.

Chong J.A.et.al. (1995)Cell 80:949-957
Schoenherr C.J.et.al.(1995)Science 267:1360-1363
Scholl T.et.al.(1996)J. Immunol. 156:1448-1457
Lunyak V.V.et.al. (2002)Science 298:1747-1752

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

WB, 1:500-1:2000

Validation Images & Assay Conditions

Gene/Protein Information For CEBPE (Source: Uniprot.org, NCBI)

Gene Name

CEBPE

Full Name

CCAAT/enhancer-binding protein epsilon

Weight

30603 MW

Superfamily

bZIP family

Alternative Names

C/EBP-epsilon; CCAAT/enhancer binding protein (C/EBP), epsilon; CCAAT/enhancer-binding protein epsilon; CEBP epsilon; CEBPE; CRP1C/EBP epsilon CEBPE C/EBP-epsilon, CRP1, c/EBP epsilon CCAAT enhancer binding protein epsilon CCAAT/enhancer-binding protein epsilon|CCAAT/enhancer binding protein (C/EBP), epsilon

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on CEBPE, check out the CEBPE Infographic

CEBPE infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CEBPE: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A03884-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-C/EBP epsilon CEBPE Antibody?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-C/EBP epsilon CEBPE Antibody

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-C/EBP epsilon CEBPE Antibody

Question

Is a blocking peptide available for product anti-C/EBP epsilon antibody (A03884-1)?

Verified Customer

Verified customer

Asked: 2020-01-07

Answer

We do provide the blocking peptide for product anti-C/EBP epsilon antibody (A03884-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-01-07

Question

We are currently using anti-C/EBP epsilon antibody A03884-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on canine tissues as well?

R. Taylor

Verified customer

Asked: 2018-11-29

Answer

The anti-C/EBP epsilon antibody (A03884-1) has not been validated for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-11-29

Question

Does anti-C/EBP epsilon antibody A03884-1 work on primate WB with brain?

P. Jha

Verified customer

Asked: 2015-11-25

Answer

Our lab technicians have not tested anti-C/EBP epsilon antibody A03884-1 on primate. You can run a BLAST between primate and the immunogen sequence of anti-C/EBP epsilon antibody A03884-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated primate samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in primate brain in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2015-11-25

Order DetailsPrice
A03884-1

100uL

$399

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A03884-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$399.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.