Product Info Summary
SKU: | A03884-1 |
---|---|
Size: | 100μl |
Reactive Species: | Human |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-C/EBP epsilon CEBPE Antibody
View all CEBP epsilon Antibodies
SKU/Catalog Number
A03884-1
Size
100μl
Form
Liquid
Description
Boster Bio Anti-C/EBP epsilon CEBPE Antibody catalog # A03884-1. Tested in WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-C/EBP epsilon CEBPE Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03884-1)
Host
Rabbit
Contents
Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.
Clonality
Polyclonal
Isotype
IgG
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PRDM9 Synthetic peptide CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Reactive Species
A03884-1 is reactive to CEBPE in Human
Applications
A03884-1 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
39 kDa
Calculated molecular weight
30603 MW
Background of CEBP epsilon
Transcriptional repressor which binds neuron-restrictive silencer element (NRSE) and represses neuronal gene transcription in non-neuronal cells. Restricts the expression of neuronal genes by associating with two distinct corepressors, mSin3 and CoREST, which in turn recruit histone deacetylase to the promoters of REST-regulated genes. Mediates repression by recruiting the BHC complex at RE1/NRSE sites which acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier.
Chong J.A.et.al. (1995)Cell 80:949-957
Schoenherr C.J.et.al.(1995)Science 267:1360-1363
Scholl T.et.al.(1996)J. Immunol. 156:1448-1457
Lunyak V.V.et.al. (2002)Science 298:1747-1752
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
WB, 1:500-1:2000
Validation Images & Assay Conditions
![a03884 1 western blotting analysis 2 a03884 1 western blotting analysis 2](https://www.bosterbio.com/media/catalog/product/a/0/a03884-1-western-blotting-analysis-2.jpg)
Click image to see more details
Western Blot (WB) analysis of Jurkat cells using C/EBP epsilon Polyclonal antibody.
![a03884 1 western blotting analysis 1 a03884 1 western blotting analysis 1](https://www.bosterbio.com/media/catalog/product/a/0/a03884-1-western-blotting-analysis-1.jpg)
Click image to see more details
Western Blot (WB) analysis of specific cells using C/EBP epsilon Polyclonal antibody.
Protein Target Info & Infographic
Gene/Protein Information For CEBPE (Source: Uniprot.org, NCBI)
Gene Name
CEBPE
Full Name
CCAAT/enhancer-binding protein epsilon
Weight
30603 MW
Superfamily
bZIP family
Alternative Names
C/EBP-epsilon; CCAAT/enhancer binding protein (C/EBP), epsilon; CCAAT/enhancer-binding protein epsilon; CEBP epsilon; CEBPE; CRP1C/EBP epsilon CEBPE C/EBP-epsilon, CRP1, c/EBP epsilon CCAAT enhancer binding protein epsilon CCAAT/enhancer-binding protein epsilon|CCAAT/enhancer binding protein (C/EBP), epsilon
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on CEBPE, check out the CEBPE Infographic
![CEBPE infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CEBPE: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-C/EBP epsilon CEBPE Antibody (A03884-1)
Hello CJ!
No publications found for A03884-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-C/EBP epsilon CEBPE Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-C/EBP epsilon CEBPE Antibody
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
3 Customer Q&As for Anti-C/EBP epsilon CEBPE Antibody
Question
Is a blocking peptide available for product anti-C/EBP epsilon antibody (A03884-1)?
Verified Customer
Verified customer
Asked: 2020-01-07
Answer
We do provide the blocking peptide for product anti-C/EBP epsilon antibody (A03884-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-01-07
Question
We are currently using anti-C/EBP epsilon antibody A03884-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on canine tissues as well?
R. Taylor
Verified customer
Asked: 2018-11-29
Answer
The anti-C/EBP epsilon antibody (A03884-1) has not been validated for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-11-29
Question
Does anti-C/EBP epsilon antibody A03884-1 work on primate WB with brain?
P. Jha
Verified customer
Asked: 2015-11-25
Answer
Our lab technicians have not tested anti-C/EBP epsilon antibody A03884-1 on primate. You can run a BLAST between primate and the immunogen sequence of anti-C/EBP epsilon antibody A03884-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated primate samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in primate brain in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2015-11-25