Click image to see more details
Product Info Summary
| SKU: | PB9687 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Rat |
| Host: | Rabbit |
| Application: | ELISA, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-BMP2 Antibody Picoband®
SKU/Catalog Number
PB9687
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-BMP2 Antibody Picoband® catalog # PB9687. Tested in ELISA, IHC, WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-BMP2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9687)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9687 is reactive to BMP2 in Human, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
20 kDa, 40 kDa
Calculated molecular weight
44702 MW
Background of BMP2
BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily. BMP-2, like other bone morphogenetic proteins, plays an important role in the development of bone and cartilage. It is involved in the hedgehog pathway, TGF beta signaling pathway, and in cytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation and epithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9687 is guaranteed for ELISA, IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
ELISA(Cap) , 1-5μg/ml, Human, -
Positive Control
WB: Rat Lung Tissue, Rat Brain Tissue, U87 Whole Cell, HELA Whole Cell
IHC: human intestinal cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of BMP-2 using anti-BMP-2 antibody (PB9687).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: Rat Lung Tissue Lysate at 50ug,
Lane 2: Rat Brain Tissue Lysate at 50ug,
Lane 3: U87 Whole Cell Lysate at 40ug,
Lane 4: HELA Whole Cell Lysate at 40ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-BMP-2 antigen affinity purified polyclonal antibody (Catalog # PB9687) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for BMP-2 at approximately 20 kDa, 40 kDa. The expected band size for BMP-2 is at 45 kDa.
Click image to see more details
Figure 2. IHC analysis of BMP-2 using anti-BMP-2 antibody (PB9687).
BMP-2 was detected in a paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-BMP-2 Antibody (PB9687) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. Sandwich ELISA - Recombinant mouse BMP2 protein standard curve.
Use in combination with reagents from Mouse BMP2 ELISA Kit EZ-Set (DIY Antibody Pairs) (EZ0313).
Protein Target Info & Infographic
Gene/Protein Information For BMP2 (Source: Uniprot.org, NCBI)
Gene Name
BMP2
Full Name
Bone morphogenetic protein 2
Weight
44702 MW
Superfamily
TGF-beta family
Alternative Names
Bone morphogenetic protein 2;BMP-2;Bone morphogenetic protein 2A;BMP-2A;BMP2;BMP2A; BMP2 BDA2A, SSFSC, SSFSC1, BMP2 bone morphogenetic protein 2 bone morphogenetic protein 2|bone morphogenetic protein 2A
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on BMP2, check out the BMP2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for BMP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-BMP2 Antibody Picoband® (PB9687)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-BMP2 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-BMP2 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
13 Customer Q&As for Anti-BMP2 Antibody Picoband®
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for thyroid gland using anti-BMP2 antibody PB9687. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-02-27
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-02-27
Question
Can you help my question with product PB9687, anti-BMP2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-12-17
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9687 anti-BMP2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-12-17
Question
Do you have a BSA free version of anti-BMP2 antibody PB9687 available?
Verified Customer
Verified customer
Asked: 2019-11-28
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-BMP2 antibody PB9687 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-11-28
Question
Is this PB9687 anti-BMP2 antibody reactive to the isotypes of BMP2?
Verified Customer
Verified customer
Asked: 2019-10-24
Answer
The immunogen of PB9687 anti-BMP2 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2 (283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-10-24
Question
I was wanting to use your anti-BMP2 antibody for ELISA for human thyroid gland on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human thyroid gland identification?
Verified Customer
Verified customer
Asked: 2019-09-06
Answer
It shows on the product datasheet, PB9687 anti-BMP2 antibody has been tested for ELISA, IHC, WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in human thyroid gland in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-09-06
Question
Will anti-BMP2 antibody PB9687 work for ELISA with thyroid gland?
Verified Customer
Verified customer
Asked: 2019-01-07
Answer
According to the expression profile of thyroid gland, BMP2 is highly expressed in thyroid gland. So, it is likely that anti-BMP2 antibody PB9687 will work for ELISA with thyroid gland.
Boster Scientific Support
Answered: 2019-01-07
Question
I am looking for using your anti-BMP2 antibody for transcriptional regulation by runx2 studies. Has this antibody been tested with western blotting on rat lung tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-01-01
Answer
We appreciate your inquiry. This PB9687 anti-BMP2 antibody is validated on rat lung tissue, tissue lysate, brain tissue, u87 whole cell lysate, hela whole cell lysate, intestinal cancer tissue. It is guaranteed to work for ELISA, IHC, WB in human, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-01-01
Question
See attached the WB image, lot number and protocol we used for thyroid gland using anti-BMP2 antibody PB9687. Please let me know if you require anything else.
Z. Krishna
Verified customer
Asked: 2018-03-06
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-03-06
Question
I see that the anti-BMP2 antibody PB9687 works with ELISA, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2017-09-27
Answer
You can find protocols for ELISA on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2017-09-27
Question
Will PB9687 anti-BMP2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2017-09-06
Answer
You can see on the product datasheet, PB9687 anti-BMP2 antibody as been validated on ELISA. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-09-06
Question
We are interested in to test anti-BMP2 antibody PB9687 on human thyroid gland for research purposes, then I may be interested in using anti-BMP2 antibody PB9687 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
L. Mangal
Verified customer
Asked: 2017-03-29
Answer
The products we sell, including anti-BMP2 antibody PB9687, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2017-03-29
Question
Is a blocking peptide available for product anti-BMP2 antibody (PB9687)?
K. Taylor
Verified customer
Asked: 2015-01-26
Answer
We do provide the blocking peptide for product anti-BMP2 antibody (PB9687). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2015-01-26
Question
We are currently using anti-BMP2 antibody PB9687 for human tissue, and we are well pleased with the ELISA results. The species of reactivity given in the datasheet says human, rat. Is it possible that the antibody can work on horse tissues as well?
A. Krishna
Verified customer
Asked: 2014-11-26
Answer
The anti-BMP2 antibody (PB9687) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2014-11-26
