Product Info Summary
SKU: | A01857-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Chicken, Human, Monkey, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Beta Tubulin/TUBB Antibody Picoband®
View all beta Tubulin Antibodies
SKU/Catalog Number
A01857-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Beta Tubulin/TUBB Antibody Picoband® catalog # A01857-1. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat, Chicken. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Beta Tubulin/TUBB Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01857-1)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
A01857-1 is reactive to TUBB in Chicken, Human, Monkey, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
50 kDa
Calculated molecular weight
50433 MW
Background of beta Tubulin
Tubulin beta chain is a protein that in humans is encoded by the TUBB gene. This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A01857-1 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Monkey, Mouse, Rat, Chicken
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat
Immunocytochemistry/Immunofluorescence, 5μg/ml, Human
Flow Cytometry(Fixed), 1-3μg/1x106 cells, Human
Positive Control
WB: human SiHa whole cell, human 293T whole cell, human HepG2 whole cell, monkey COS-7 whole cell, chicken heart tissue, rat brain tissue, rat PC-12 whole cell, mouse brain tissue, mouse NIH/3T3 whole cell
IHC: human liver cancer tissue, human testicular germ cell tumor tissue
ICC/IF: U20S cell
FCM: SiHa cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Beta Tubulin using anti-Beta Tubulin antibody (A01857-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human SiHa whole cell lysates,
Lane 2: human 293T whole cell lysates,
Lane 3: human HepG2 whole cell lysates,
Lane 4: monkey COS-7 whole cell lysates,
Lane 5: chicken heart tissue lysates,
Lane 6: rat brain tissue lysates,
Lane 7: rat PC-12 whole cell lysates,
Lane 8: mouse brain tissue lysates,
Lane 9: mouse NIH/3T3 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Beta Tubulin antigen affinity purified polyclonal antibody (Catalog # A01857-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Beta Tubulin at approximately 50 kDa. The expected band size for Beta Tubulin is at 50 kDa.
Click image to see more details
Figure 2. IHC analysis of Beta Tubulin using anti-Beta Tubulin antibody (A01857-1).
Beta Tubulin was detected in a paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-Beta Tubulin Antibody (A01857-1) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of Beta Tubulin using anti-Beta Tubulin antibody (A01857-1).
Beta Tubulin was detected in a paraffin-embedded section of human testicular germ cell tumor tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-Beta Tubulin Antibody (A01857-1) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
Figure 4. IF analysis of Beta Tubulin using anti-Beta Tubulin antibody (A01857-1).
Beta Tubulin was detected in an immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 μg/mL rabbit anti-Beta Tubulin Antibody (A01857-1) overnight at 4°C. Cy3 Conjugated Goat Anti-Rabbit IgG (BA1032) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 5. Flow Cytometry analysis of SiHa cells using anti-Beta Tubulin antibody (A01857-1).
Overlay histogram showing SiHa cells stained with A01857-1 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Beta Tubulin Antibody (A01857-1, 1 μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10 μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1 μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For TUBB (Source: Uniprot.org, NCBI)
Gene Name
TUBB
Full Name
Tubulin beta chain
Weight
50433 MW
Superfamily
tubulin family
Alternative Names
Tubulin beta chain; Tubulin beta-5 chain; TUBB; TUBB5; OK/SW-cl.56 TUBB CDCBM6, CSCSC1, M40, OK/SW-cl.561, TUBB5, TUBB tubulin beta class I tubulin beta chain|beta Ib tubulin|epididymis secretory sperm binding protein|tubulin beta-1 chain|tubulin beta-5 chain|tubulin, beta polypeptide
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on TUBB, check out the TUBB Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TUBB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Beta Tubulin/TUBB Antibody Picoband® (A01857-1)
Hello CJ!
A01857-1 has been cited in 7 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Stemness distinctions between the ectomesenchymal stem cells from neonatal and adult mice
Shan W,Han F,Xu Y,Shi Y.Stathmin Regulates Spatiotemporal Variation in the Memory Loop in Single-Prolonged Stress Rats. J Mol Neurosci. 2020 Apr;70(4):576-589.doi: 10.1007/s12031-019-01459-w.Epub 2020 Jan 13.PMID: 31933182.
Species: Rat
A01857-1 usage in article: APP:WB, SAMPLE:BRAIN TISSUE, DILUTION:1:1000
Hu X,Lu E,Pan C,Xu Y,Zhu X.Overexpression and biological function of PRDX6 in human cervical cancer.J Cancer.2020 Feb 10;11(9):2390-2400.doi:10.7150/jca.39892.PMID:32201510;PMCID:PMC7066013.
Species: Human
A01857-1 usage in article: APP:WB, SAMPLE:SIHA CELLS,HELA CELLS,CASKI CELLS,MS751 CELLS AND C33A CELLS, DILUTION:1:2000
Nrf2/ARE pathway involved in oxidative stress induced by paraquat in human neural progenitor cells
Pim-3 is a Critical Risk Factor in Development and Prognosis of Prostate Cancer
The Potential Role of HMGB1 Release in Peritoneal Dialysis-Related Peritonitis
Lentiviral-mediated growth-associated protein-43 modification of bone marrow mesenchymal stem cells improves traumatic optic neuropathy in rats
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Beta Tubulin/TUBB Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Beta Tubulin/TUBB Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-Beta Tubulin/TUBB Antibody Picoband®
Question
Is this A01857-1 anti-Beta Tubulin/TUBB antibody reactive to the isotypes of TUBB?
Verified Customer
Verified customer
Asked: 2020-04-06
Answer
The immunogen of A01857-1 anti-Beta Tubulin/TUBB antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-04-06
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung using anti-Beta Tubulin/TUBB antibody A01857-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-12-31
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-12-31
Question
Is a blocking peptide available for product anti-Beta Tubulin/TUBB antibody (A01857-1)?
Verified Customer
Verified customer
Asked: 2019-12-09
Answer
We do provide the blocking peptide for product anti-Beta Tubulin/TUBB antibody (A01857-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-12-09
Question
Would anti-Beta Tubulin/TUBB antibody A01857-1 work for WB with lung?
Verified Customer
Verified customer
Asked: 2019-09-19
Answer
According to the expression profile of lung, TUBB is highly expressed in lung. So, it is likely that anti-Beta Tubulin/TUBB antibody A01857-1 will work for WB with lung.
Boster Scientific Support
Answered: 2019-09-19
Question
I have attached the WB image, lot number and protocol we used for lung using anti-Beta Tubulin/TUBB antibody A01857-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-09-12
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-09-12
Question
I have a question about product A01857-1, anti-Beta Tubulin/TUBB antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-08-12
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01857-1 anti-Beta Tubulin/TUBB antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-08-12
Question
Would A01857-1 anti-Beta Tubulin/TUBB antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
A. Carter
Verified customer
Asked: 2014-02-24
Answer
You can see on the product datasheet, A01857-1 anti-Beta Tubulin/TUBB antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2014-02-24