Anti-Beta Tubulin/TUBB Antibody Picoband™

beta Tubulin antibody

Boster Bio Anti-Beta Tubulin/TUBB Antibody Picoband™ catalog # A01857-1. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat, Chicken. Cited in 7 publication(s).

Product Info Summary

SKU: A01857-1
Size: 100 μg/vial
Reactive Species: Chicken, Human, Monkey, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Product Name

Anti-Beta Tubulin/TUBB Antibody Picoband™

View all beta Tubulin Antibodies

SKU/Catalog Number

A01857-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Beta Tubulin/TUBB Antibody Picoband™ catalog # A01857-1. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat, Chicken.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Beta Tubulin/TUBB Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01857-1)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

A01857-1 is reactive to TUBB in Chicken, Human, Monkey, Mouse, Rat

Applications

A01857-1 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Observed Molecular Weight

50 kDa

Calculated molecular weight

50433 MW

Background of beta Tubulin

Tubulin beta chain is a protein that in humans is encoded by the TUBB gene. This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Monkey, Mouse, Rat, Chicken
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat
Immunocytochemistry/Immunofluorescence, 5μg/ml, Human
Flow Cytometry(Fixed), 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For TUBB (Source: Uniprot.org, NCBI)

Gene Name

TUBB

Full Name

Tubulin beta chain

Weight

50433 MW

Superfamily

tubulin family

Alternative Names

beta polypeptide; MGC117247; Tubb5; tubulin beta chain; tubulin beta polypeptide; tubulin beta-1 chain; Tubulin beta-5 chain; tubulin, beta TUBB CDCBM6, CSCSC1, M40, OK/SW-cl.561, TUBB5, TUBB tubulin beta class I tubulin beta chain|beta Ib tubulin|epididymis secretory sperm binding protein|tubulin beta-1 chain|tubulin beta-5 chain|tubulin, beta polypeptide

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on TUBB, check out the TUBB Infographic

TUBB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TUBB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A01857-1 has been cited in 7 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Stemness distinctions between the ectomesenchymal stem cells from neonatal and adult mice

Shan W,Han F,Xu Y,Shi Y.Stathmin Regulates Spatiotemporal Variation in the Memory Loop in Single-Prolonged Stress Rats. J Mol Neurosci. 2020 Apr;70(4):576-589.doi: 10.1007/s12031-019-01459-w.Epub 2020 Jan 13.PMID: 31933182.
Species: Rat
A01857-1 usage in article: APP:WB, SAMPLE:BRAIN TISSUE, DILUTION:1:1000

Hu X,Lu E,Pan C,Xu Y,Zhu X.Overexpression and biological function of PRDX6 in human cervical cancer.J Cancer.2020 Feb 10;11(9):2390-2400.doi:10.7150/jca.39892.PMID:32201510;PMCID:PMC7066013.
Species: Human
A01857-1 usage in article: APP:WB, SAMPLE:SIHA CELLS,HELA CELLS,CASKI CELLS,MS751 CELLS AND C33A CELLS, DILUTION:1:2000

Nrf2/ARE pathway involved in oxidative stress induced by paraquat in human neural progenitor cells

Pim-3 is a Critical Risk Factor in Development and Prognosis of Prostate Cancer

The Potential Role of HMGB1 Release in Peritoneal Dialysis-Related Peritonitis

Lentiviral-mediated growth-associated protein-43 modification of bone marrow mesenchymal stem cells improves traumatic optic neuropathy in rats

Have you used Anti-Beta Tubulin/TUBB Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Beta Tubulin/TUBB Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-Beta Tubulin/TUBB Antibody Picoband™

Question

Is this A01857-1 anti-Beta Tubulin/TUBB antibody reactive to the isotypes of TUBB?

Verified Customer

Verified customer

Asked: 2020-04-06

Answer

The immunogen of A01857-1 anti-Beta Tubulin/TUBB antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-06

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung using anti-Beta Tubulin/TUBB antibody A01857-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-12-31

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-12-31

Question

Is a blocking peptide available for product anti-Beta Tubulin/TUBB antibody (A01857-1)?

Verified Customer

Verified customer

Asked: 2019-12-09

Answer

We do provide the blocking peptide for product anti-Beta Tubulin/TUBB antibody (A01857-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-12-09

Question

Would anti-Beta Tubulin/TUBB antibody A01857-1 work for WB with lung?

Verified Customer

Verified customer

Asked: 2019-09-19

Answer

According to the expression profile of lung, TUBB is highly expressed in lung. So, it is likely that anti-Beta Tubulin/TUBB antibody A01857-1 will work for WB with lung.

Boster Scientific Support

Answered: 2019-09-19

Question

I have attached the WB image, lot number and protocol we used for lung using anti-Beta Tubulin/TUBB antibody A01857-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-09-12

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-09-12

Question

I have a question about product A01857-1, anti-Beta Tubulin/TUBB antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-08-12

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01857-1 anti-Beta Tubulin/TUBB antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-08-12

Question

Would A01857-1 anti-Beta Tubulin/TUBB antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

A. Carter

Verified customer

Asked: 2014-02-24

Answer

You can see on the product datasheet, A01857-1 anti-Beta Tubulin/TUBB antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2014-02-24

Order DetailsPrice
A01857-1

100μg

$370
A01857-1-10ug

10μg sample (liquid)

$99
A01857-1-Biotin

100 μg Biotin conjugated

$570
A01857-1-Cy3

100 μg Cy3 conjugated

$570
A01857-1-Dylight488

100 μg Dylight488 conjugated

$570
A01857-1-Dylight550

100 μg Dylight550 conjugated

$570
A01857-1-Dylight594

100 μg Dylight594 conjugated

$570
A01857-1-FITC

100 μg FITC conjugated

$570
A01857-1-HRP

100 μg HRP conjugated

$570
A01857-1-APC

100 μg APC conjugated

$670
A01857-1-PE

100 μg PE conjugated

$670
A01857-1-iFluor647

100 μg iFluor647 conjugated

$670
A01857-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01857-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.