Click image to see more details
Product Info Summary
| SKU: | PB9917 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | Flow Cytometry, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Bcl-X/BCL2L1 Antibody Picoband®
SKU/Catalog Number
PB9917
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Bcl-X/BCL2L1 Antibody Picoband® catalog # PB9917. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Bcl-X/BCL2L1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9917)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9917 is reactive to BCL2L1 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
29 kDa, 60 kDa
Calculated molecular weight
26049 MW
Background of BCL2L1
Bcl-2-like protein 1, also known as Bcl-X, is a protein that in humans is encoded by the BCL2L1 gene. The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform (Bcl-xL) acts as an apoptotic inhibitor and the shorter form (Bcl-xS) acts as an apoptotic activator.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9917 is guaranteed for Flow Cytometry, IHC, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human
Immunocytochemistry, 0.5-1μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human
Positive Control
WB: SW620 whole cell
FCM: PC-3 cell, A549 cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Bcl-X using anti-Bcl-X antibody (PB9917).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: SW620 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Bcl-X antigen affinity purified polyclonal antibody (Catalog # PB9917) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Bcl-X at approximately 29 KD, 60KD. The expected band size for Bcl-X is at 26KD.
Click image to see more details
Figure 2. Flow Cytometry analysis of PC-3 cells using anti-Bcl-X antibody (PB9917).
Overlay histogram showing PC-3 cells stained with PB9917 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Bcl-X Antibody (PB9917,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Click image to see more details
Figure 3. Flow Cytometry analysis of A549 cells using anti-Bcl-X antibody (PB9917).
Overlay histogram showing A549 cells stained with PB9917 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Bcl-X Antibody (PB9917,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For BCL2L1 (Source: Uniprot.org, NCBI)
Gene Name
BCL2L1
Full Name
Bcl-2-like protein 1
Weight
26049 MW
Superfamily
Bcl-2 family
Alternative Names
Bcl-2-like protein 1;Bcl2-L-1;Apoptosis regulator Bcl-X;BCL2L1;BCL2L, BCLX; BCL2L1 BCL-XL/S, BCL2L, BCLX, Bcl-X, PPP1R52 BCL2 like 1 bcl-2-like protein 1|apoptosis regulator Bcl-X|protein phosphatase 1, regulatory subunit 52
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on BCL2L1, check out the BCL2L1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for BCL2L1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Bcl-X/BCL2L1 Antibody Picoband® (PB9917)
Hello CJ!
PB9917 has been cited in 5 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
The role of cofilin-l in vulvar squamous cell carcinoma: A marker of carcinogenesis, progression and targeted therapy
ACTX-8, a cytotoxic l-amino acid oxidase isolated from Agkistrodon acutus snake venom, induces apoptosis in Hela cervical cancer cells
Relationship between Egr-1 gene expression and apoptosis in esophageal carcinoma and precancerous lesions
Emodin alleviates severe acute pancreatitis-associated acute lung injury by decreasing pre-B-cell colony-enhancing factor expression and promoting polymorphonuclear neutrophil apoptosis
Zhou X, Zhang Y, Li Y, Hao X, Liu X, Wang Y. Cancers (Basel). 2012 Dec 4;4(4):1318-32. Doi: 10.3390/Cancers4041318. Azithromycin Synergistically Enhances Anti-Proliferative Activity Of Vincristine In Cervical And Gastric Cancer Cells.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Bcl-X/BCL2L1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Bcl-X/BCL2L1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-Bcl-X/BCL2L1 Antibody Picoband®
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung using anti-Bcl-X/BCL2L1 antibody PB9917. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-04-03
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-04-03
Question
Will anti-Bcl-X/BCL2L1 antibody PB9917 work for Flow Cytometry with lung?
Verified Customer
Verified customer
Asked: 2020-03-19
Answer
According to the expression profile of lung, BCL2L1 is highly expressed in lung. So, it is likely that anti-Bcl-X/BCL2L1 antibody PB9917 will work for Flow Cytometry with lung.
Boster Scientific Support
Answered: 2020-03-19
Question
Would PB9917 anti-Bcl-X/BCL2L1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-02-20
Answer
It shows on the product datasheet, PB9917 anti-Bcl-X/BCL2L1 antibody as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-02-20
Question
I see that the anti-Bcl-X/BCL2L1 antibody PB9917 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-11-13
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-11-13
Question
Is a blocking peptide available for product anti-Bcl-X/BCL2L1 antibody (PB9917)?
Verified Customer
Verified customer
Asked: 2019-10-17
Answer
We do provide the blocking peptide for product anti-Bcl-X/BCL2L1 antibody (PB9917). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-10-17
Question
Here is the WB image, lot number and protocol we used for lung using anti-Bcl-X/BCL2L1 antibody PB9917. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-09-25
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-09-25
Question
Do you have a BSA free version of anti-Bcl-X/BCL2L1 antibody PB9917 available?
F. Miller
Verified customer
Asked: 2019-09-16
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Bcl-X/BCL2L1 antibody PB9917 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-09-16
Question
We have been able to see staining in human upper lobe of left lung. What should we do? Is anti-Bcl-X/BCL2L1 antibody supposed to stain upper lobe of left lung positively?
Verified Customer
Verified customer
Asked: 2019-07-31
Answer
From literature upper lobe of left lung does express BCL2L1. From Uniprot.org, BCL2L1 is expressed in upper lobe of left lung, colon carcinoma, lung, among other tissues. Regarding which tissues have BCL2L1 expression, here are a few articles citing expression in various tissues:
Colon carcinoma, Pubmed ID: 17974005
Lung, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2019-07-31
Question
We were content with the WB result of your anti-Bcl-X/BCL2L1 antibody. However we have observed positive staining in colon carcinoma isoform bcl-x(l): mitochondrion inner using this antibody. Is that expected? Could you tell me where is BCL2L1 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-07-16
Answer
From what I have seen in literature, colon carcinoma does express BCL2L1. Generally BCL2L1 expresses in isoform bcl-x(l): mitochondrion inner. Regarding which tissues have BCL2L1 expression, here are a few articles citing expression in various tissues:
Colon carcinoma, Pubmed ID: 17974005
Lung, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2019-07-16
Question
We are currently using anti-Bcl-X/BCL2L1 antibody PB9917 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on horse tissues as well?
E. Wu
Verified customer
Asked: 2019-06-28
Answer
The anti-Bcl-X/BCL2L1 antibody (PB9917) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-06-28
Question
I was wanting to use your anti-Bcl-X/BCL2L1 antibody for Flow Cytometry for human lung on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human lung identification?
Verified Customer
Verified customer
Asked: 2019-05-17
Answer
You can see on the product datasheet, PB9917 anti-Bcl-X/BCL2L1 antibody has been tested for Flow Cytometry, IHC, ICC, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human lung in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-05-17
Question
My lab would like using your anti-Bcl-X/BCL2L1 antibody for fertilization studies. Has this antibody been tested with western blotting on a549 cells? We would like to see some validation images before ordering.
N. Jackson
Verified customer
Asked: 2018-09-17
Answer
Thank you for your inquiry. This PB9917 anti-Bcl-X/BCL2L1 antibody is tested on sw620 whole cell lysates, a549 cells. It is guaranteed to work for Flow Cytometry, IHC, ICC, WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2018-09-17
Question
Our lab want to know about to test anti-Bcl-X/BCL2L1 antibody PB9917 on human lung for research purposes, then I may be interested in using anti-Bcl-X/BCL2L1 antibody PB9917 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-08-30
Answer
The products we sell, including anti-Bcl-X/BCL2L1 antibody PB9917, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-08-30
Question
I have a question about product PB9917, anti-Bcl-X/BCL2L1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2018-08-03
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9917 anti-Bcl-X/BCL2L1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-08-03
Question
Is this PB9917 anti-Bcl-X/BCL2L1 antibody reactive to the isotypes of BCL2L1?
N. Evans
Verified customer
Asked: 2016-01-27
Answer
The immunogen of PB9917 anti-Bcl-X/BCL2L1 antibody is A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2016-01-27
Question
Our lab used your anti-Bcl-X/BCL2L1 antibody for IHC on colon carcinoma in a previous experiment. I am using human, and We are going to use the antibody for Flow Cytometry next. We need examining colon carcinoma as well as upper lobe of left lung in our next experiment. Do you have any suggestion on which antibody would work the best for Flow Cytometry?
O. Williams
Verified customer
Asked: 2015-02-12
Answer
I looked at the website and datasheets of our anti-Bcl-X/BCL2L1 antibody and it appears that PB9917 has been validated on human in both IHC and Flow Cytometry. Thus PB9917 should work for your application. Our Boster satisfaction guarantee will cover this product for Flow Cytometry in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for Flow Cytometry detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2015-02-12
