Anti-AHR Antibody Picoband®

AHR antibody

Boster Bio Anti-AHR Antibody Picoband® catalog # A00225-2. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 1 publication(s).

Product Info Summary

SKU: A00225-2
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, ICC, WB

Product Name

Anti-AHR Antibody Picoband®

View all AHR Antibodies

SKU/Catalog Number

A00225-2

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-AHR Antibody Picoband® catalog # A00225-2. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-AHR Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00225-2)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Standard Protein

A synthetic peptide corresponding to a sequence at the C-terminus of human AHR.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00225-2 is reactive to AHR in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

100 kDa

Background of AHR

AHR (aryl hydrocarbon receptor), also called bHLHe76, is a member of the family of basic helix-loop-helix transcription factors. AhR is a cytosolic transcription factor that is normally inactive, bound to several co-chaperones. The AHR gene is mapped on 7p21.1. Estrogenic actions of AHR agonists were detected in wildtype ovariectomized mouse uteri, but were absent in Ahr -/- or Er-alpha -/- ovariectomized mice. Complex assembly and ubiquitin ligase activity of CUL4B (AHR) in vitro and in vivo are dependent on the AHR ligand. In the CUL4B (AHR) complex, ligand-activated AHR acts as a substrate-specific adaptor component that targets sex steroid receptors for degradation. Cd4-positive cells from mice lacking Ahr developed Th17 responses but failed to produce Il22 and did not show enhanced Th17 development. Activation of Ahr during induction of EAE accelerated disease onset and increased pathology in wildtype mice, but not in Ahr -/- mice. The TDO-AHR pathway is active in human brain tumors and is associated with malignant progression and poor survival. Ahr activity within ROR-gamma-t-positive ILC could be induced by dietary ligands such as those contained in vegetables of the family Brassicaceae.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00225-2 is guaranteed for Flow Cytometry, IHC, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry, 0.5-1μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells

Positive Control

WB: human HEK293 whole cell
IHC: human placenta tissue, human cholangiocarcinoma tissue, human oesophagus squama cancer tissue, human tonsil tissue, mouse liver tissue, rat small intestine tissue, rat spleen tissue
FCM: U87 cell, U937 cell

Validation Images & Assay Conditions

Gene/Protein Information For AHR (Source: Uniprot.org, NCBI)

Gene Name

AHR

Full Name

Aryl hydrocarbon receptor

Weight

Alternative Names

Ah receptor; AHR; AH-receptor; aryl hydrocarbon receptor; BHLHE76; bHLHe76aromatic hydrocarbon receptor; Class E basic helix-loop-helix protein 76 AHR RP85, bHLHe76 aryl hydrocarbon receptor aryl hydrocarbon receptor|AH-receptor|ah receptor|aromatic hydrocarbon receptor|class E basic helix-loop-helix protein 76

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on AHR, check out the AHR Infographic

AHR infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AHR: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A00225-2 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Yang X,Liu H,Ye T,Duan C,Lv P,Wu X,Liu J,Jiang K,Lu H,Yang H,Xia D,Peng E,Chen Z,Tang K,Ye Z. AhR activation attenuates calcium oxalate nephrocalcinosis by diminishing M1 macrophage polarization and promoting M2 macrophage polarization. Theranostics.2020
Species: Mouse
A00225-2 usage in article: APP:IHC, SAMPLE:KIDNEY TISSUE, DILUTION:1:100

Have you used Anti-AHR Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-AHR Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-AHR Antibody Picoband®

Question

I have a question about product A00225-2, anti-AHR antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-04-27

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00225-2 anti-AHR antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-04-27

Question

Would anti-AHR antibody A00225-2 work for IHC with placenta?

Verified Customer

Verified customer

Asked: 2020-04-08

Answer

According to the expression profile of placenta, AHR is highly expressed in placenta. So, it is likely that anti-AHR antibody A00225-2 will work for IHC with placenta.

Boster Scientific Support

Answered: 2020-04-08

Question

See below the WB image, lot number and protocol we used for placenta using anti-AHR antibody A00225-2. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-03-24

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-03-24

Question

I was wanting to use your anti-AHR antibody for IHC for human placenta on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human placenta identification?

Verified Customer

Verified customer

Asked: 2020-02-17

Answer

It shows on the product datasheet, A00225-2 anti-AHR antibody has been tested for Flow Cytometry, IHC, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human placenta in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-02-17

Question

Our lab used your anti-AHR antibody for Flow Cytometry on placenta in the past. I am using human, and We intend to use the antibody for WB next. We are interested in examining placenta as well as liver in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?

Verified Customer

Verified customer

Asked: 2020-01-14

Answer

I viewed the website and datasheets of our anti-AHR antibody and I see that A00225-2 has been tested on human in both Flow Cytometry and WB. Thus A00225-2 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2020-01-14

Question

We were well pleased with the WB result of your anti-AHR antibody. However we have observed positive staining in liver cytoplasm. using this antibody. Is that expected? Could you tell me where is AHR supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-11-25

Answer

Based on literature, liver does express AHR. Generally AHR expresses in cytoplasm. Regarding which tissues have AHR expression, here are a few articles citing expression in various tissues:
Liver, Pubmed ID: 8393992
Placenta, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-11-25

Question

I see that the anti-AHR antibody A00225-2 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-11-12

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-11-12

Question

Is this A00225-2 anti-AHR antibody reactive to the isotypes of AHR?

Verified Customer

Verified customer

Asked: 2019-09-30

Answer

The immunogen of A00225-2 anti-AHR antibody is A synthetic peptide corresponding to a sequence of human AHR (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-09-30

Question

Does A00225-2 anti-AHR antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-09-24

Answer

You can see on the product datasheet, A00225-2 anti-AHR antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-09-24

Question

We have observed staining in rat liver. Do you have any suggestions? Is anti-AHR antibody supposed to stain liver positively?

Verified Customer

Verified customer

Asked: 2019-07-10

Answer

Based on literature liver does express AHR. Based on Uniprot.org, AHR is expressed in placenta, liver, among other tissues. Regarding which tissues have AHR expression, here are a few articles citing expression in various tissues:
Liver, Pubmed ID: 8393992
Placenta, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-07-10

Question

We are interested in using your anti-AHR antibody for cellular response to forskolin studies. Has this antibody been tested with western blotting on placenta tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-03-15

Answer

I appreciate your inquiry. This A00225-2 anti-AHR antibody is validated on human cholangiocarcinoma tissue, placenta tissue, squama cancer tissue, tonsil tissue, mouse liver tissue, rat spleen tissue, small intestine tissue, u87 cells, u937 cells. It is guaranteed to work for Flow Cytometry, IHC, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-03-15

Question

We are currently using anti-AHR antibody A00225-2 for rat tissue, and we are happy with the ICC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on bovine tissues as well?

P. Evans

Verified customer

Asked: 2018-10-23

Answer

The anti-AHR antibody (A00225-2) has not been tested for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-10-23

Question

My question regards to test anti-AHR antibody A00225-2 on human placenta for research purposes, then I may be interested in using anti-AHR antibody A00225-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-01-11

Answer

The products we sell, including anti-AHR antibody A00225-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-01-11

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-AHR antibody A00225-2. Let me know if you need anything else.

K. Bhatt

Verified customer

Asked: 2014-05-27

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2014-05-27

Question

Is there a BSA free version of anti-AHR antibody A00225-2 available?

D. Zhang

Verified customer

Asked: 2013-05-20

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-AHR antibody A00225-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2013-05-20

Question

Is a blocking peptide available for product anti-AHR antibody (A00225-2)?

G. Evans

Verified customer

Asked: 2013-02-26

Answer

We do provide the blocking peptide for product anti-AHR antibody (A00225-2). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2013-02-26

Order DetailsPrice
A00225-2

100μg

$370
A00225-2-10ug

10μg sample (liquid)

$99
A00225-2-Biotin

100 μg Biotin conjugated

$570
A00225-2-Cy3

100 μg Cy3 conjugated

$570
A00225-2-Dylight488

100 μg Dylight488 conjugated

$570
A00225-2-Dylight550

100 μg Dylight550 conjugated

$570
A00225-2-Dylight594

100 μg Dylight594 conjugated

$570
A00225-2-FITC

100 μg FITC conjugated

$570
A00225-2-HRP

100 μg HRP conjugated

$570
A00225-2-APC

100 μg APC conjugated

$670
A00225-2-PE

100 μg PE conjugated

$670
A00225-2-iFluor647

100 μg iFluor647 conjugated

$670
A00225-2-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00225-2
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.