Anti-14-3-3 theta/ tau YWHAQ Antibody

Product Name

Anti-14-3-3 theta/ tau YWHAQ Antibody

View all YWHAQ Antibodies

SKU/Catalog Number

A03904

Size

100μl

Form

Liquid

Description

Boster Bio Anti-14-3-3 theta/ tau YWHAQ Antibody catalog # A03904. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-14-3-3 theta/ tau YWHAQ Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03904)

Host

Rabbit

Contents

Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.

Clonality

Polyclonal

Isotype

IgG

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SULF2 Synthetic peptide DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Reactive Species

A03904 is reactive to YWHAQ in Human, Mouse, Rat

Applications

A03904 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

39 kDa

Calculated molecular weight

27764 MW

Background of YWHAQ

Transcriptional repressor which binds neuron-restrictive silencer element (NRSE) and represses neuronal gene transcription in non-neuronal cells. Restricts the expression of neuronal genes by associating with two distinct corepressors, mSin3 and CoREST, which in turn recruit histone deacetylase to the promoters of REST-regulated genes. Mediates repression by recruiting the BHC complex at RE1/NRSE sites which acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier.

Chong J.A.et.al. (1995)Cell 80:949-957
Schoenherr C.J.et.al.(1995)Science 267:1360-1363
Scholl T.et.al.(1996)J. Immunol. 156:1448-1457
Lunyak V.V.et.al. (2002)Science 298:1747-1752

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

WB, 1:500-1:2000

Validation Images & Assay Conditions

Click image to see more details

Western Blot (WB) analysis of specific cells using 14-3-3 theta/tau Polyclonal antibody.

Gene/Protein Information For YWHAQ (Source: Uniprot.org, NCBI)

Alternative Names

14-3-3 protein tau; 14-3-3 protein T-cell; 14-3-3 protein theta; 1433; 14-3-3; 14-3-3,1C5; HS1; Protein HS1; protein tau; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, thetapolypeptide YWHAQ 14-3-3, 1C5, HS1 tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta 14-3-3 protein theta|14-3-3 protein T-cell|14-3-3 protein tau|14-3-3 theta|protein, theta|tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide

For more info on YWHAQ, check out the YWHAQ Infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for YWHAQ: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Take me to the YWHAQ Infographic

Here are featured tools and databases that you might find useful.

• Boster's Pathways Library
• Protein Databases
• Bioscience Research Protocol Resources
• Data Processing & Analysis Software
• Photo Editing Software
• Scientific Literature Resources
• Research Paper Management Tools
• Molecular Biology Software
• Primer Design Tools
• Bioinformatics Tools
• Phylogenetic Tree Analysis