AKR1D1 (NM_005989) Human Recombinant Protein

AKR1D1 protein,

Product Info Summary

SKU: PROTP51857
Size: 20 µg
Source: HEK293T

Product Name

AKR1D1 (NM_005989) Human Recombinant Protein

View all AKR1D1 recombinant proteins

SKU/Catalog Number

PROTP51857

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

AKR1D1 (NM_005989) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP51857)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

37.2 kDa

Amino Acid Sequence

MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY

Validation Images & Assay Conditions

Gene/Protein Information For AKR1D1 (Source: Uniprot.org, NCBI)

Gene Name

AKR1D1

Full Name

Aldo-keto reductase family 1 member D1

Weight

37.2 kDa

Superfamily

aldo/keto reductase family

Alternative Names

3o5bred; Aldo-keto reductase family 1 member D1,3-oxo-5-beta-steroid 4-dehydrogenase; aldo-keto reductase family 1, member D1 (delta4-3-ketosteroid-5-beta-reductase); CBAS2; Delta(4)-3-oxosteroid 5-beta-reductase; EC 1.3.1.3; SRD5B1beta polypeptide 1 (3-oxo-5 beta-steroid delta4-dehydrogenase beta 1) AKR1D1 3o5bred, CBAS2, SRD5B1 aldo-keto reductase family 1 member D1 aldo-keto reductase family 1 member D1|delta(4)-3-ketosteroid 5-beta-reductase|delta(4)-3-oxosteroid 5-beta-reductase|steroid-5-beta-reductase, beta polypeptide 1 (3-oxo-5 beta-steroid delta 4-dehydrogenase beta 1)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on AKR1D1, check out the AKR1D1 Infographic

AKR1D1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AKR1D1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP51857

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used AKR1D1 (NM_005989) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For AKR1D1 (NM_005989) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for AKR1D1 (NM_005989) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP51857
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.