Adropin (ENHO) (NM_198573) Human Recombinant Protein

Adropin protein,

Product Info Summary

SKU: PROTQ6UWT2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Adropin (ENHO) (NM_198573) Human Recombinant Protein

View all Adropin recombinant proteins

SKU/Catalog Number

PROTQ6UWT2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human energy homeostasis associated (ENHO)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Adropin (ENHO) (NM_198573) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6UWT2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

7.7 kDa

Amino Acid Sequence

MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP

Validation Images & Assay Conditions

Gene/Protein Information For ENHO (Source: Uniprot.org, NCBI)

Gene Name

ENHO

Full Name

Adropin

Weight

7.7 kDa

Alternative Names

Adropin; C9orf165; chromosome 9 open reading frame 165; energy homeostasis associated; Energy homeostasis-associated protein; ENHO; GAAI470; UNQ470 Enho|1110065P19Rik, 2310040A07Rik, A|energy homeostasis associated|adropin|energy homeostasis-associated protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ENHO, check out the ENHO Infographic

ENHO infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ENHO: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6UWT2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Adropin (ENHO) (NM_198573) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Adropin (ENHO) (NM_198573) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Adropin (ENHO) (NM_198573) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6UWT2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.