14-3-3 beta (YWHAB) (NM_139323) Human Recombinant Protein

YWHAB protein,

Product Info Summary

SKU: PROTP31946
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

14-3-3 beta (YWHAB) (NM_139323) Human Recombinant Protein

View all YWHAB recombinant proteins

SKU/Catalog Number

PROTP31946

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide (YWHAB), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

14-3-3 beta (YWHAB) (NM_139323) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP31946)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.9 kDa

Amino Acid Sequence

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Validation Images & Assay Conditions

Gene/Protein Information For YWHAB (Source: Uniprot.org, NCBI)

Gene Name

YWHAB

Full Name

14-3-3 protein beta/alpha

Weight

27.9 kDa

Superfamily

14-3-3 family

Alternative Names

14-3-3 alpha; 14-3-3 beta; 14-3-3 protein beta/alpha; brain protein 14-3-3, beta isoform; GW128; HS1; KCIP-1; Protein 1054; Protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, alphapolypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, betapolypeptide; YWHAA YWHAB GW128, HEL-S-1, HS1, KCIP-1, YWHAA tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta 14-3-3 protein beta/alpha|14-3-3 alpha|epididymis secretory protein Li 1|protein 1054|protein kinase C inhibitor protein-1|tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, alpha polypeptide|tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on YWHAB, check out the YWHAB Infographic

YWHAB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for YWHAB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP31946

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used 14-3-3 beta (YWHAB) (NM_139323) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For 14-3-3 beta (YWHAB) (NM_139323) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for 14-3-3 beta (YWHAB) (NM_139323) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP31946
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product