ZPBP2 (NM_199321) Human Recombinant Protein

Zpbp2 protein,

Purified recombinant protein of Homo sapiens zona pellucida binding protein 2 (ZPBP2), transcript variant 2

Product Info Summary

SKU: PROTQ6X784
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ZPBP2 (NM_199321) Human Recombinant Protein

View all Zpbp2 recombinant proteins

SKU/Catalog Number

PROTQ6X784

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens zona pellucida binding protein 2 (ZPBP2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ZPBP2 (NM_199321) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6X784)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

38.5 kDa

Amino Acid Sequence

MMRTCVLLSAVLWCLTGVQCPRFTLFNKKGFIYGKTGQPDKIYVELHQNSPVLICMDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQEEKTVKKRYDFMVFAYREPDYSYQMAVRFTTRSCIGRYNDVFFRVLKKILDSLISDLSCHVIEPSYKCHSVEIPEHGLIHELFIAFQVNPFAPGWKGACNGSVDCEDTTNHNILQARDRIEDFFRSQAYIFYHNFNKTLPAMHFVDHSLQVVRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYGAKSCPQTSNKNQQYED

Validation Images & Assay Conditions

Gene/Protein Information For ZPBP2 (Source: Uniprot.org, NCBI)

Gene Name

ZPBP2

Full Name

Zona pellucida-binding protein 2

Weight

38.5 kDa

Superfamily

zona pellucida-binding protein Sp38 family

Alternative Names

CAAX prenyl protease 1 homolog; EC 3.4.24.84; FACE1FLJ14968; FACE-1zinc metalloproteinase (STE24 homolog, yeast); Farnesylated proteins-converting enzyme 1; farnesylated-proteins converting enzyme 1; HGPS; Hutchinson-Gilford progeria syndrome; MADB; Prenyl protein-specific endoprotease 1; PRO1; Ste24p; STE24zinc metallopeptidase (STE24 homolog, yeast); zinc metallopeptidase (STE24 homolog, S. cerevisiae); Zinc metalloproteinase Ste24 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZPBP2, check out the ZPBP2 Infographic

ZPBP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZPBP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6X784

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ZPBP2 (NM_199321) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ZPBP2 (NM_199321) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ZPBP2 (NM_199321) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6X784
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.