ZNF207 (NM_001098507) Human Recombinant Protein

ZNF207 protein,

Purified recombinant protein of Homo sapiens zinc finger protein 207 (ZNF207), transcript variant 3

Product Info Summary

SKU: PROTO43670
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ZNF207 (NM_001098507) Human Recombinant Protein

View all ZNF207 recombinant proteins

SKU/Catalog Number

PROTO43670

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens zinc finger protein 207 (ZNF207), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ZNF207 (NM_001098507) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43670)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

52.5 kDa

Amino Acid Sequence

MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDDSAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGLHHQRKYTQSFCGENIMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSASSKALFPSTAQAQAAVQGPVGTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRY

Validation Images & Assay Conditions

Gene/Protein Information For ZNF207 (Source: Uniprot.org, NCBI)

Gene Name

ZNF207

Full Name

BUB3-interacting and GLEBS motif-containing protein ZNF207

Weight

52.5 kDa

Alternative Names

DKFZp761N202; zinc finger protein 207 ZNF207 BuGZ, hBuGZ zinc finger protein 207 BUB3-interacting and GLEBS motif-containing protein ZNF207

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZNF207, check out the ZNF207 Infographic

ZNF207 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZNF207: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used ZNF207 (NM_001098507) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ZNF207 (NM_001098507) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ZNF207 (NM_001098507) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43670
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.