ZCCHC9 (NM_032280) Human Recombinant Protein

Zcchc9 protein,

Recombinant protein of human zinc finger, CCHC domain containing 9 (ZCCHC9), transcript variant 1

Product Info Summary

SKU: PROTQ8N567
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ZCCHC9 (NM_032280) Human Recombinant Protein

View all Zcchc9 recombinant proteins

SKU/Catalog Number

PROTQ8N567

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human zinc finger, CCHC domain containing 9 (ZCCHC9), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ZCCHC9 (NM_032280) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N567)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.3 kDa

Amino Acid Sequence

MTRWARVSTTYNKRALPATSWEDMKKGSFEGTSQNLPKRKQLEANRLSLKNDAPQAKHKKNKKKKEYLNEDVNGFMEYLRQNSQMVHNGQIIATDSEEVREEIAVALKKDSRREGRRLKRQAAKKNAMVCFHCRKPGHGIADCPAALENQDMGTGICYRCGSTEHEITKCKAKVDPALGEFPFAKCFVCGEMGHLSRSCPDNPKGLYADGGGCKLCGSVEHLKKDCPESQNSERMVTVGRWAKGMSADYEEILDVPKPQKPKTKIPKVVNF

Validation Images & Assay Conditions

Gene/Protein Information For ZCCHC9 (Source: Uniprot.org, NCBI)

Gene Name

ZCCHC9

Full Name

Zinc finger CCHC domain-containing protein 9

Weight

30.3 kDa

Alternative Names

DKFZp761J139; zinc finger CCHC domain-containing protein 9; zinc finger, CCHC domain containing 9

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZCCHC9, check out the ZCCHC9 Infographic

ZCCHC9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZCCHC9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8N567

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ZCCHC9 (NM_032280) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ZCCHC9 (NM_032280) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ZCCHC9 (NM_032280) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N567
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.