XPA (NM_000380) Human Recombinant Protein

XPA protein,

Product Info Summary

SKU: PROTP23025
Size: 20 µg
Source: HEK293T

Product Name

XPA (NM_000380) Human Recombinant Protein

View all XPA recombinant proteins

SKU/Catalog Number

PROTP23025

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens xeroderma pigmentosum, complementation group A (XPA), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

XPA (NM_000380) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP23025)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31.2 kDa

Amino Acid Sequence

MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM

Validation Images & Assay Conditions

Gene/Protein Information For XPA (Source: Uniprot.org, NCBI)

Gene Name

XPA

Full Name

DNA repair protein complementing XP-A cells

Weight

31.2 kDa

Superfamily

XPA family

Alternative Names

DNA repair protein complementing XP-A cells; excision repair-controlling; Xeroderma pigmentosum group A-complementing protein; xeroderma pigmentosum, complementation group A; XP1; XPA; XPACXP1 XPA XP1C, XPA XPA, DNA damage recognition and repair factor DNA repair protein complementing XP-A cells|xeroderma pigmentosum group A-complementing protein|xeroderma pigmentosum, complementation group A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on XPA, check out the XPA Infographic

XPA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for XPA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP23025

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used XPA (NM_000380) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For XPA (NM_000380) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for XPA (NM_000380) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP23025
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.