WDR26 (NM_001115113) Human Recombinant Protein

WDR26 protein,

Purified recombinant protein of Homo sapiens WD repeat domain 26 (WDR26), transcript variant 2

Product Info Summary

SKU: PROTQ9H7D7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

WDR26 (NM_001115113) Human Recombinant Protein

View all WDR26 recombinant proteins

SKU/Catalog Number

PROTQ9H7D7

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens WD repeat domain 26 (WDR26), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

WDR26 (NM_001115113) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H7D7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

70.3 kDa

Amino Acid Sequence

MQESGCRLEHPSATKFRNHVMEGDWDKAENDLNELKPLVHSPHAIVRMKFLLLQQKYLEYLEDGKVLEALQVLRCELTPLKYNTERIHVLSGYLMCSHAEDLRAKAEWEGKGTASRSKLLDKLQTYLPPSVMLPPRRLQTLLRQAVELQRDRCLYHNTKLDNNLDSVSLLIDHVCSRRQFPCYTQQILTEHCNEVWFCKFSNDGTKLATGSKDTTVIIWQVDPDTHLLKLLKTLEGHAYGVSYIAWSPDDNYLVACGPDDCSELWLWNVQTGELRTKMSQSHEDSLTSVAWNPDGKRFVTGGQRGQFYQCDLDGNLLDSWEGVRVQCLWCLSDGKTVLASDTHQRIRGYNFEDLTDRNIVQEDHPIMSFTISKNGRLALLNVATQGVHLWDLQDRVLVRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHKRSELPIAELTGHTRTVNCVSWNPQIPSMMASASDDGTVRIWGPAPFIDHQNIEEECSSMDS

Validation Images & Assay Conditions

Gene/Protein Information For WDR26 (Source: Uniprot.org, NCBI)

Gene Name

WDR26

Full Name

WD repeat-containing protein 26

Weight

70.3 kDa

Alternative Names

MIP2; myocardial ischemic preconditioning up-regulated protein 2; WD repeat domain 26; WD repeat-containing protein 26 WDR26 CDW2, GID7, MIP2, SKDEAS WD repeat domain 26 WD repeat-containing protein 26|CUL4- and DDB1-associated WDR protein 2|GID complex subunit 7 homolog|myocardial ischemic preconditioning upregulated protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on WDR26, check out the WDR26 Infographic

WDR26 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for WDR26: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H7D7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used WDR26 (NM_001115113) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For WDR26 (NM_001115113) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for WDR26 (NM_001115113) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H7D7
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product