WDFY2 (NM_052950) Human Recombinant Protein

WDFY2 protein,

Recombinant protein of human WD repeat and FYVE domain containing 2 (WDFY2)

Product Info Summary

SKU: PROTQ96P53
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

WDFY2 (NM_052950) Human Recombinant Protein

View all WDFY2 recombinant proteins

SKU/Catalog Number

PROTQ96P53

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human WD repeat and FYVE domain containing 2 (WDFY2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

WDFY2 (NM_052950) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96P53)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

45 kDa

Amino Acid Sequence

MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEEGVISVSEDRTVRVWLKRDSGQYWPSVYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS

Validation Images & Assay Conditions

Gene/Protein Information For WDFY2 (Source: Uniprot.org, NCBI)

Gene Name

WDFY2

Full Name

WD repeat and FYVE domain-containing protein 2

Weight

45 kDa

Alternative Names

propeller-FYVE protein; RP11-147H23.1; WD repeat and FYVE domain containing 2; WD repeat and FYVE domain-containing protein 2; WD40 and FYVE domain containing 2; WD40- and FYVE domain-containing protein 2; WDF2; ZFYVE22PROF; Zinc finger FYVE domain-containing protein 22 WDFY2 PROF, WDF2, ZFYVE22 WD repeat and FYVE domain containing 2 WD repeat and FYVE domain-containing protein 2|WD40 and FYVE domain containing 2|WD40- and FYVE domain-containing protein 2|propeller-FYVE protein|zinc finger FYVE domain-containing protein 22

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on WDFY2, check out the WDFY2 Infographic

WDFY2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for WDFY2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96P53

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used WDFY2 (NM_052950) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For WDFY2 (NM_052950) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for WDFY2 (NM_052950) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96P53
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.