VPS33A (NM_022916) Human Recombinant Protein

Vps33a protein,

Recombinant protein of human vacuolar protein sorting 33 homolog A (S. cerevisiae) (VPS33A)

Product Info Summary

SKU: PROTQ96AX1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

VPS33A (NM_022916) Human Recombinant Protein

View all Vps33a recombinant proteins

SKU/Catalog Number

PROTQ96AX1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human vacuolar protein sorting 33 homolog A (S. cerevisiae) (VPS33A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

VPS33A (NM_022916) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96AX1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

67.4 kDa

Amino Acid Sequence

MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF

Validation Images & Assay Conditions

Gene/Protein Information For VPS33A (Source: Uniprot.org, NCBI)

Gene Name

VPS33A

Full Name

Vacuolar protein sorting-associated protein 33A

Weight

67.4 kDa

Superfamily

STXBP/unc-18/SEC1 family

Alternative Names

FLJ22395; FLJ23187; hVPS33A; vacuolar protein sorting 33 homolog A (S. cerevisiae); vacuolar protein sorting 33A (yeast); vacuolar protein sorting 33A; vacuolar protein sorting-associated protein 33A Vps33a|r-Vps33a|VPS33A core subunit of CORVET and HOPS complexes|vacuolar protein sorting-associated protein 33A|VPS33A CORVET/HOPS core subunit|vacuolar protein sorting 33 homolog A|vacuolar protein sorting 33A|vacuolar protein sorting protein 33a

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on VPS33A, check out the VPS33A Infographic

VPS33A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for VPS33A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96AX1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used VPS33A (NM_022916) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For VPS33A (NM_022916) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for VPS33A (NM_022916) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96AX1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.