VENTX (NM_014468) Human Recombinant Protein

VENTX protein,

Recombinant protein of human VENT homeobox homolog (Xenopus laevis) (VENTX)

Product Info Summary

SKU: PROTO95231
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

VENTX (NM_014468) Human Recombinant Protein

View all VENTX recombinant proteins

SKU/Catalog Number

PROTO95231

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human VENT homeobox homolog (Xenopus laevis) (VENTX)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

VENTX (NM_014468) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95231)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.4 kDa

Amino Acid Sequence

MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSPGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF

Validation Images & Assay Conditions

Gene/Protein Information For VENTX (Source: Uniprot.org, NCBI)

Gene Name

VENTX

Full Name

Homeobox protein VENTX

Weight

27.4 kDa

Alternative Names

homeobox protein VENTX; HPX42BNA88A; MGC119910; MGC119911; VENT homeobox homolog (Xenopus laevis); VENT homeobox homolog; VENT-like homeobox 2; VENT-like homeobox protein 2; VENTX2hemopoietic progenitor homeobox protein VENTX2 VENTX HPX42B, NA88A2, VENTX VENT homeobox homeobox protein VENTX|VENT homeobox homolog|VENT-like homeobox 2|VENT-like homeobox protein 2|hemopoietic progenitor homeobox protein VENTX2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on VENTX, check out the VENTX Infographic

VENTX infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for VENTX: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95231

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used VENTX (NM_014468) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For VENTX (NM_014468) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for VENTX (NM_014468) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95231
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.