VAV3 (NM_001079874) Human Recombinant Protein

VAV3 protein,

Recombinant protein of human vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 2

Product Info Summary

SKU: PROTQ9UKW4
Size: 20 µg
Source: HEK293T

Product Name

VAV3 (NM_001079874) Human Recombinant Protein

View all VAV3 recombinant proteins

SKU/Catalog Number

PROTQ9UKW4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

VAV3 (NM_001079874) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UKW4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.4 kDa

Amino Acid Sequence

MPIFTFLSEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE

Validation Images & Assay Conditions

Gene/Protein Information For VAV3 (Source: Uniprot.org, NCBI)

Gene Name

VAV3

Full Name

Guanine nucleotide exchange factor VAV3

Weight

32.4 kDa

Alternative Names

FLJ40431; guanine nucleotide exchange factor VAV3; vav 3 guanine nucleotide exchange factor; vav 3 oncogene; VAV-3 VAV3 vav guanine nucleotide exchange factor 3 guanine nucleotide exchange factor VAV3|VAV-3|vav 3 guanine nucleotide exchange factor|vav 3 oncogene

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on VAV3, check out the VAV3 Infographic

VAV3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for VAV3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UKW4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used VAV3 (NM_001079874) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For VAV3 (NM_001079874) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for VAV3 (NM_001079874) Human Recombinant Protein

Question

Is PROTQ9UKW4 not a full protein?

Verified customer

Asked: 2022-07-22

Answer

The VAV3 Human Recombinant Protein (PROTQ9UKW4) is a full length VAV3 (NM_001079874)-Myc-DDK fusion protein.

Boster Scientific Support

Answered: 2022-07-22

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UKW4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.