VAPA (NM_194434) Human Recombinant Protein

VAP-A protein,

Product Info Summary

SKU: PROTQ9P0L0
Size: 20 µg
Source: HEK293T

Product Name

VAPA (NM_194434) Human Recombinant Protein

View all VAP-A recombinant proteins

SKU/Catalog Number

PROTQ9P0L0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

VAPA (NM_194434) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9P0L0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.7 kDa

Amino Acid Sequence

MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL

Validation Images & Assay Conditions

Gene/Protein Information For VAPA (Source: Uniprot.org, NCBI)

Gene Name

VAPA

Full Name

Vesicle-associated membrane protein-associated protein A

Weight

27.7 kDa

Superfamily

VAMP-associated protein (VAP) (TC 9.B.17) family

Alternative Names

hVAP-33; MGC3745,33 kDa VAMP-associated protein; VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa; VAMP-A; VAP-33; VAP33VAMP (vesicle-associated membrane protein)-associated protein A (33kD); VAPA; VAP-A; VAP-AVAMP-associated protein A; vesicle-associated membrane protein-associated protein A VAPA VAMP-A, VAP-33, VAP-A, VAP33, hVAP-33 VAMP associated protein A vesicle-associated membrane protein-associated protein A|33 kDa VAMP-associated protein|VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa|epididymis secretory sperm binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on VAPA, check out the VAPA Infographic

VAPA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for VAPA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9P0L0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used VAPA (NM_194434) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For VAPA (NM_194434) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for VAPA (NM_194434) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9P0L0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.