UNC50 (NM_014044) Human Recombinant Protein

UNC50 protein,

Purified recombinant protein of Homo sapiens unc-50 homolog (C. elegans) (UNC50)

Product Info Summary

SKU: PROTQ53HI1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

UNC50 (NM_014044) Human Recombinant Protein

View all UNC50 recombinant proteins

SKU/Catalog Number

PROTQ53HI1

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens unc-50 homolog (C. elegans) (UNC50)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UNC50 (NM_014044) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ53HI1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.2 kDa

Amino Acid Sequence

MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVK

Validation Images & Assay Conditions

Gene/Protein Information For UNC50 (Source: Uniprot.org, NCBI)

Gene Name

UNC50

Full Name

Protein unc-50 homolog

Weight

30.2 kDa

Superfamily

unc-50 family

Alternative Names

geal-6 membrane-associated high-copy suppressor 1; GMH1; hGMH1; PDLs22; Periodontal ligament-specific protein 22; Protein GMH1 homolog; protein unc-50 homolog; unc-50 homolog (C. elegans); unc-50 related; UNCLDKFZp564G0222; Uncoordinated-like protein; URP UNC50 GMH1, HSD23, PDLs22, UNCL, URP unc-50 inner nuclear membrane RNA binding protein protein unc-50 homolog|geal-6 membrane-associated high-copy suppressor 1|periodontal ligament-specific protein 22|protein GMH1 homolog|unc-50 related|unc-50-like protein|uncoordinated-like protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UNC50, check out the UNC50 Infographic

UNC50 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UNC50: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ53HI1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UNC50 (NM_014044) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UNC50 (NM_014044) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UNC50 (NM_014044) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ53HI1
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.