UNC119B (NM_001080533) Human Recombinant Protein

UNC119B protein,

Product Info Summary

SKU: PROTA6NIH7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

UNC119B (NM_001080533) Human Recombinant Protein

View all UNC119B recombinant proteins

SKU/Catalog Number

PROTA6NIH7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human unc-119 homolog B (C. elegans) (UNC119B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UNC119B (NM_001080533) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA6NIH7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28 kDa

Amino Acid Sequence

MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRPEHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFVRYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQ

Validation Images & Assay Conditions

Gene/Protein Information For UNC119B (Source: Uniprot.org, NCBI)

Gene Name

UNC119B

Full Name

Protein unc-119 homolog B

Weight

28 kDa

Superfamily

PDE6D/unc-119 family

Alternative Names

Protein unc-119 homolog B UNC119B POC7B unc-119 lipid binding chaperone B protein unc-119 homolog B|POC7 centriolar protein homolog B|unc-119 homolog B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UNC119B, check out the UNC119B Infographic

UNC119B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UNC119B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTA6NIH7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UNC119B (NM_001080533) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UNC119B (NM_001080533) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UNC119B (NM_001080533) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA6NIH7
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.