UBL5 (NM_024292) Human Recombinant Protein

UBL5 protein,

Product Info Summary

SKU: PROTQ9BZL1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

UBL5 (NM_024292) Human Recombinant Protein

View all UBL5 recombinant proteins

SKU/Catalog Number

PROTQ9BZL1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin-like 5 (UBL5), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UBL5 (NM_024292) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BZL1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

8.4 kDa

Amino Acid Sequence

MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ

Validation Images & Assay Conditions

Gene/Protein Information For UBL5 (Source: Uniprot.org, NCBI)

Gene Name

UBL5

Full Name

Ubiquitin-like protein 5

Weight

8.4 kDa

Alternative Names

FLJ46917; HUB1; MGC131795; ubiquitin-like 5; ubiquitin-like protein 5 UBL5 HUB1 ubiquitin like 5 ubiquitin-like protein 5|beacon|testicular tissue protein Li 217

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UBL5, check out the UBL5 Infographic

UBL5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UBL5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BZL1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UBL5 (NM_024292) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UBL5 (NM_024292) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UBL5 (NM_024292) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BZL1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.