UBE2V1 (NM_001032288) Human Recombinant Protein

Uev1a/UBE2V1 protein,

Recombinant protein of human ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1), transcript variant 4

Product Info Summary

SKU: PROTQ13404
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

UBE2V1 (NM_001032288) Human Recombinant Protein

View all Uev1a/UBE2V1 recombinant proteins

SKU/Catalog Number

PROTQ13404

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1), transcript variant 4

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UBE2V1 (NM_001032288) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13404)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.3 kDa

Amino Acid Sequence

MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN

Validation Images & Assay Conditions

Gene/Protein Information For UBE2V1 (Source: Uniprot.org, NCBI)

Gene Name

UBE2V1

Full Name

Ubiquitin-conjugating enzyme E2 variant 1

Weight

16.3 kDa

Superfamily

ubiquitin-conjugating enzyme family

Alternative Names

CIR1; CROC1; CROC1TRAF6-regulated IKK activator 1 beta Uev1A; CROC-1UBE2V; UBE2V1; ubiquitin-conjugating enzyme E2 variant 1; Uev1a; UEV-1CIR1; UEV1DNA-binding protein UBE2V1 CIR1, CROC-1, CROC1, UBE2V, UEV-1, UEV1, UEV1A ubiquitin conjugating enzyme E2 V1 ubiquitin-conjugating enzyme E2 variant 1|DNA-binding protein|TRAF6-regulated IKK activator 1 beta Uev1A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UBE2V1, check out the UBE2V1 Infographic

UBE2V1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UBE2V1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13404

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UBE2V1 (NM_001032288) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UBE2V1 (NM_001032288) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UBE2V1 (NM_001032288) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13404
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.