UBE2D4 (NM_015983) Human Recombinant Protein

UBE2D4/Ubch5d protein,

Product Info Summary

SKU: PROTQ9Y2X8
Size: 20 µg
Source: HEK293T

Product Name

UBE2D4 (NM_015983) Human Recombinant Protein

View all UBE2D4/Ubch5d recombinant proteins

SKU/Catalog Number

PROTQ9Y2X8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin-conjugating enzyme E2D 4 (putative) (UBE2D4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UBE2D4 (NM_015983) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y2X8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.5 kDa

Amino Acid Sequence

MAVKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM

Validation Images & Assay Conditions

Gene/Protein Information For UBE2D4 (Source: Uniprot.org, NCBI)

Gene Name

UBE2D4

Full Name

Ubiquitin-conjugating enzyme E2 D4

Weight

16.5 kDa

Superfamily

ubiquitin-conjugating enzyme family

Alternative Names

EC 6.3.2.19; FLJ32004; HBUCE1; HBUCE1Ubiquitin carrier protein D4; Ubch5d; UBE2D4; ubiquitin-conjugating enzyme E2 D4; ubiquitin-conjugating enzyme E2D 4 (putative); ubiquitin-conjugating enzyme HBUCE1; Ubiquitin-protein ligase D4 UBE2D4 HBUCE1 ubiquitin conjugating enzyme E2 D4 (putative) ubiquitin-conjugating enzyme E2 D4|E2 ubiquitin-conjugating enzyme D4|ubiquitin carrier protein D4|ubiquitin conjugating enzyme E2D 4 (putative)|ubiquitin-conjugating enzyme HBUCE1|ubiquitin-protein ligase D4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UBE2D4, check out the UBE2D4 Infographic

UBE2D4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UBE2D4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used UBE2D4 (NM_015983) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UBE2D4 (NM_015983) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UBE2D4 (NM_015983) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y2X8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.