UBE2D3 (NM_003340) Human Recombinant Protein

UbcH5c/UBE2D3 protein,

Product Info Summary

SKU: PROTP61077
Size: 20 µg
Source: HEK293T

Product Name

UBE2D3 (NM_003340) Human Recombinant Protein

View all UbcH5c/UBE2D3 recombinant proteins

SKU/Catalog Number

PROTP61077

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UBE2D3 (NM_003340) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP61077)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.5 kDa

Amino Acid Sequence

MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM

Validation Images & Assay Conditions

Gene/Protein Information For UBE2D3 (Source: Uniprot.org, NCBI)

Gene Name

UBE2D3

Full Name

Ubiquitin-conjugating enzyme E2 D3

Weight

16.5 kDa

Superfamily

ubiquitin-conjugating enzyme family

Alternative Names

E2(17)KB 3; E2(17)KB3; EC 6.3.2.19; MGC43926; MGC5416; UBC4/5; UBC5C; UbcH5c; UBE2D3; Ubiquitin carrier protein D3; ubiquitin-conjugating enzyme E2 D3; Ubiquitin-conjugating enzyme E2(17)KB 3; Ubiquitin-conjugating enzyme E2-17 kDa 3; ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5); ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); Ubiquitin-protein ligase D3 UBE2D3 E2(17)KB3, UBC4/5, UBCH5C ubiquitin conjugating enzyme E2 D3 ubiquitin-conjugating enzyme E2 D3|(E3-independent) E2 ubiquitin-conjugating enzyme D3|E2 ubiquitin-conjugating enzyme D3|ubiquitin carrier protein D3|ubiquitin conjugating enzyme E2D 3|ubiquitin-conjugating enzyme E2(17)KB 3|ubiquitin-conjugating enzyme E2-17 kDa 3|ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)|ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5)|ubiquitin-protein ligase D3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UBE2D3, check out the UBE2D3 Infographic

UBE2D3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UBE2D3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used UBE2D3 (NM_003340) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UBE2D3 (NM_003340) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UBE2D3 (NM_003340) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP61077
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.