UBC3B (UBE2R2) (NM_017811) Human Recombinant Protein

UBE2R2 protein,

Product Info Summary

SKU: PROTQ712K3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

UBC3B (UBE2R2) (NM_017811) Human Recombinant Protein

View all UBE2R2 recombinant proteins

SKU/Catalog Number

PROTQ712K3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin-conjugating enzyme E2R 2 (UBE2R2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UBC3B (UBE2R2) (NM_017811) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ712K3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27 kDa

Amino Acid Sequence

MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES

Validation Images & Assay Conditions

Gene/Protein Information For UBE2R2 (Source: Uniprot.org, NCBI)

Gene Name

UBE2R2

Full Name

Ubiquitin-conjugating enzyme E2 R2

Weight

27 kDa

Superfamily

ubiquitin-conjugating enzyme family

Alternative Names

CDC34B; CDC34BEC 6.3.2.19; E2-CDC34B; FLJ20419; MGC10481; UBC3B; UBC3BUbiquitin-protein ligase R2; UBE2R2; Ubiquitin carrier protein R2; ubiquitin-conjugating enzyme E2 R2; Ubiquitin-conjugating enzyme E2-CDC34B; ubiquitin-conjugating enzyme E2R 2; ubiquitin-conjugating enzyme UBC3B UBE2R2 CDC34B, E2-CDC34B, UBC3B ubiquitin conjugating enzyme E2 R2 ubiquitin-conjugating enzyme E2 R2|E2 ubiquitin-conjugating enzyme R2|ubiquitin carrier protein R2|ubiquitin conjugating enzyme E2R 2|ubiquitin-conjugating enzyme E2-CDC34B|ubiquitin-conjugating enzyme UBC3B|ubiquitin-protein ligase R2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UBE2R2, check out the UBE2R2 Infographic

UBE2R2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UBE2R2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ712K3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UBC3B (UBE2R2) (NM_017811) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UBC3B (UBE2R2) (NM_017811) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UBC3B (UBE2R2) (NM_017811) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ712K3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.