TXNDC4 (ERP44) (NM_015051) Human Recombinant Protein

ERP44 protein,

Product Info Summary

SKU: PROTQ9BS26
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TXNDC4 (ERP44) (NM_015051) Human Recombinant Protein

View all ERP44 recombinant proteins

SKU/Catalog Number

PROTQ9BS26

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human endoplasmic reticulum protein 44 (ERP44)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TXNDC4 (ERP44) (NM_015051) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BS26)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46.8 kDa

Amino Acid Sequence

MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL

Validation Images & Assay Conditions

Gene/Protein Information For ERP44 (Source: Uniprot.org, NCBI)

Gene Name

ERP44

Full Name

Endoplasmic reticulum resident protein 44

Weight

46.8 kDa

Alternative Names

endoplasmic reticulum protein 44; endoplasmic reticulum resident protein 44 kDa; ER protein 44; ERp44; KIAA0573endoplasmic reticulum resident protein 44; PDIA10; protein disulfide isomerase family A, member 10; thioredoxin domain containing 4 (endoplasmic reticulum); Thioredoxin domain-containing protein 4; TXNDC4 ERP44 PDIA10, TXNDC4 endoplasmic reticulum protein 44 endoplasmic reticulum resident protein 44|ER protein 44|endoplasmic reticulum resident protein 44 kDa|epididymis secretory sperm binding protein|protein disulfide isomerase family A, member 10|thioredoxin domain containing 4 (endoplasmic reticulum)|thioredoxin domain-containing protein 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ERP44, check out the ERP44 Infographic

ERP44 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ERP44: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used TXNDC4 (ERP44) (NM_015051) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TXNDC4 (ERP44) (NM_015051) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TXNDC4 (ERP44) (NM_015051) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BS26
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.